CAZyme Information: MGYG000001304_00430

Basic Information

• Species: Erysipelatoclostridium spiroforme
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium spiroforme
• CAZyme ID: MGYG000001304_00430
• CAZy Family: CBM40
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1574		174530.96	4.2391

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001304	2507485	Isolate	not provided	North America

• Gene Location: Start: 15818; End: 20542 Strand: +

Full Sequence      

MSVPIYAQESRIAPTNQYSVDQVTTITNGSGAINASEDVANYANLDQFTLNGTFSFTSNS
NSGVNAIFFIGDNTTANNYFTLYAIPSSKRLGVELRNISGNQMLSNSYVTLNDVDFTMEH
KVTFTMSKNNYFRIYLDGKKVLEGNAPSGFTNEVIDNPNYMGFGVGSRASGNNYPMTGNL
KNLELYNCALSESEIMSYHLGALESIAYKYENIYYQDSNVQRVQDNENISKLVSMDSGSI
SIRYKVNDQNLGRMSLFSISDNLSENKYIDLYVDPSNNIFGLDVEGTKDFVMPTTSLNRA
NRTVKDTSWHTITITKENGNAKGFMFYLDGAYVDKYTSAVPEGFFSLLADANAVNFGFID
TSGDDLESLTGAIDYVRAYNEILDPSTILQEHTLTNWQPGQEIDMTNAIKTENEDLYYAG
YENSSSYRIPSLLKTSKGTLLAAIDKRITGAQDCGNIDIAVRRREANQENFGDPIIINDL
ISNPNNPSSSAFLIDSSMVEDKETGRIFLLADMFPESSGLMDTSQLTTGTGYKEIDGVDY
LQLFDQAGNEYTVRPEDGFGYVYDSQNNKTGYTVILESDAPYHERGSLYLNGEYKGNIYM
LKNGPEKGELHVLNTQYLWLYYSDDDGKTWSNPIDITPQVKADWMMFLGTGPGVGIQMED
GTLGFPVYSANKNVGGSQSSAMIISNDGGKTWQLGDSPQTNMGNDRETMNNSGKMFTESQ
AVQLNNGQVKLFMRNTYANKVYVATSSDNGLTWDKVEQIDINEVYCQLSVTNFTRNGKEY
VVMTNPDHSPRTQGMVHIGEVDQATGDITWLDSQILNTGKFLYSCLSVLQNDDEDVRFGL
LYEDDTDGTFRIKYTEFNDDFIYAGTKTEELKDPKLVDYNVSFDNDKINVALTFDQELLA
IGNPQLKLNVGSQEIIADYKEGSSSDTIFFEATLPKQINGVMKAVELLETNGIIENIKNG
KVAVLNTNIYDFTEITSGITVSSYTSQHSSSTAENTDGAAVNVIDGNINTYWHSTWGNAN
INLPQSVTLKLDKTKTLYKLAYTPRQNSNNGRIKEYEIATSIDGNEFTTVASGQWVDSKD
IQYVEFIPTDANYIKITATEAYGGGAKQSCNIAEIGLFEYSDGVINVGDKTALTNLVNTV
KDLDTSIYAKPTVDNLINAINEAQKLLDTNLVSQQMLDNAYTKLINAKTALINISKATNA
LAKLDELKEENYTPESWQIFINELTTLKEQLNDITSSREVLDIVVKADYIESQLIKAEIT
DTNKTALKIAIDIASLISEESLENVIPVVVDEFKAALSEANEVYNNTSATQKEVNNAFDR
LANAMQKLEFYKGNKTKLIEAIEEANSKQEEDYTANSWKALQEALQEANKILADENVMQK
EVDEATNKLQEALDNLVTTVDKSLLQVFVEYVSGLDSNKYTEATWKAFETELTEANVILK
DANATQEQVDNAYNQLVKAYLDLRLIPDKSLLEELINKAEGLNVANYTKATFDGLTKALN
EAKAVYENPNATQKEVDSAKATLEKAINNLEVTPINNGDTTSVKTGDSSYITTSLGLIMT
SGLIASYLKKKKKS

Enzyme Prediction     

No EC number prediction in MGYG000001304_00430.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	417	853	1e-93	0.9532163742690059
CBM40	210	394	1.5e-46	0.9832402234636871
CBM40	22	197	1.5e-43	0.9553072625698324
CBM32	986	1115	1.5e-22	0.9435483870967742

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.01e-74	414	858	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam00754	F5_F8_type_C	2.68e-19	992	1115	6	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG4409	NanH	1.56e-15	371	845	234	704	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13088	BNR_2	1.86e-15	604	761	71	206	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13859	BNR_3	3.40e-12	595	694	68	166	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE33273.1	5.80e-127	229	1530	213	1229
QAS61444.1	5.80e-127	229	1530	213	1229
ATD57534.1	6.58e-119	228	1456	213	1220
QBJ75069.1	6.58e-119	228	1456	213	1220
ATD54786.1	6.58e-119	228	1456	213	1220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVZ_A	1.52e-93	408	899	3	503	Structureof the catalytic domain of Streptococcus pneumoniae sialidase NanA [Streptococcus pneumoniae],2VVZ_B Structure of the catalytic domain of Streptococcus pneumoniae sialidase NanA [Streptococcus pneumoniae]
2W20_A	9.56e-93	408	862	1	469	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]
3H72_A	1.14e-92	408	862	5	473	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]
7A54_A	2.11e-92	408	862	28	496	ChainA, Sialidase A [Streptococcus pneumoniae],7A54_B Chain B, Sialidase A [Streptococcus pneumoniae],7A5X_A Chain A, Sialidase A [Streptococcus pneumoniae],7A5X_B Chain B, Sialidase A [Streptococcus pneumoniae]
2YA4_A	8.64e-92	408	862	22	490	Crystalstructure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA4_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA5_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA5_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA6_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA6_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA7_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_C Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_D Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA8_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4],2YA8_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P62576	1.14e-99	218	969	132	883	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
P62575	1.14e-99	218	969	132	883	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
P29767	4.60e-95	229	959	213	929	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
Q27701	4.21e-40	225	843	103	729	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
Q02834	2.09e-22	414	1104	54	632	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.977831	0.021601	0.000282	0.000117	0.000049	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001304_00430.