CAZyme Information: MGYG000001304_00902

Basic Information

• Species: Erysipelatoclostridium spiroforme
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium spiroforme
• CAZyme ID: MGYG000001304_00902
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1273		139892.14	4.1353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001304	2507485	Isolate	not provided	North America

• Gene Location: Start: 89791; End: 93612 Strand: +

Full Sequence      

MKVKRKTSKVLKSGLAATFVFSLIATNPSQILALSNVSNATENVTADIYPKPQSVSYLSD
VGMSLEGEVNVVVHGEQETATLPALEKILKDNGISYVIGQEIDENKANILVSSSKDHCDE
CASEDSALSQKEGYILTASDDENSKGEITIVGADVDGAYYGVITLGQILDQSIDNKFAEI
VVSDYPEIEFRGFIEGFYGIPWTHEERMSLMSDTGKYKMNTYIYAPKDDPYHRAQWRELY
PEKEAAQIAELAEAGKNSNFNFCWTIHPGDHINLYSEEDFQAALNKLEQLYELGVRQFGV
LFDDISNNQNGTAQANFINRIDDEFVKVKGDVKPLITVGTRYCAAWGPSMTGYLKPFVET
LHDDVEVMWTGSGTMSNISRDIYEWPKQQIGSDKDFAVWWNYPVNDYCDGKLLMGPMNSL
STDLNNVNSFFSNPMNQAEASKVSLFSIADYTWNTDAYDYMESWHRSIKELVPEIAEEFE
RFASNISYLNDGIQMDESAYLDEKVNALKVALSSGTNIKEAAQVLLEEFEVILADCDKLK
DVGNEALQTEINPFVGAYRELAIAGINSMQALIAIEDGDSALALARVSVAQESYDAMSNY
TVNRLEDAGERNVVVEVGTHSLKPIVRTVIDTANEKIGELLFPQTVAEMITNVDGLESKE
VTVTDGNFILEGVNATLNNGEYLGVILPQARNVSQISVTGANLADLDLEYSINGLDWQKA
EVSKDNGISMSTKVSTTYVRLVNNTNAPIDVTIDALQINPIYATEASASTNMGTYQTYNI
SNIIDSNRETKFWNNANPSVGQYIQIDFGAAMPLYDITAYFASGDYIKNGKVQISVDGNE
WRDVGALEYENVGANKVSSLNANGKEARYVRYVVTGSQDVWVQLFEVEYNQTVGDMGNHV
VKLTDSNTDGLHAKVCDQDITTAFAPTGIEDGDYLTYQMSRINNVADLIVVQDPNNISEA
KVSVKDINGTWREVGILDNQVVTLPVDGRITEVKLEFDSTKPLPIIYEIVATQRTAVETD
KTALKIAVDLANAITDEDLAKLIPAVADEFKVARDEANAVYNDASASQVEVNNAFDRLAS
AMHMLDFVKGDKTALKAFIDKVTGLEAAKYTEATWTAFETELNEAIAVYDDENAMQEEVN
TAYSELVTAFLNLRLIPDKSLLEDLINQANGLNGVNYTKATFDGLTKALNEAKAVYENPN
ATQEEVDNAKVTLEKAIAGLQIVTTDNTVSTPVNNGDTTASVKTGDDVNMLGTSAGLALL
SIAGAKVLRKKED

Enzyme Prediction     

No EC number prediction in MGYG000001304_00902.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	191	483	1e-109	0.9932203389830508
CBM32	763	887	3e-18	0.967741935483871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	2.00e-140	191	482	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	2.01e-13	765	881	1	119	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02838	Glyco_hydro_20b	4.09e-13	47	184	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam07554	FIVAR	3.35e-06	1162	1220	3	68	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.
cd00057	FA58C	2.98e-05	766	887	14	141	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD57955.1	0.0	3	1220	1	1244
SLK13973.1	0.0	3	1220	1	1244
QBJ74644.1	0.0	3	1220	1	1244
ATD54361.1	0.0	3	1220	1	1244
AYE33733.1	0.0	3	1220	1	1239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OXD_A	7.20e-101	47	608	17	569	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2J62_A	8.04e-101	47	608	15	567	Structureof a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2J62_B Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2WB5_A GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens],2WB5_B GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens]
4ZXL_A	2.67e-100	47	608	7	559	CpOGAD298N in complex with Drosophila HCF -derived Thr-O-GlcNAc peptide [Clostridium perfringens ATCC 13124]
2YDQ_A	3.63e-100	47	608	17	569	CpOGAD298N in complex with hOGA-derived O-GlcNAc peptide [Clostridium perfringens],2YDR_A CpOGA D298N in complex with p53-derived O-GlcNAc peptide [Clostridium perfringens],2YDS_A CpOGA D298N in complex with TAB1-derived O-GlcNAc peptide [Clostridium perfringens]
6RHE_A	3.83e-100	47	608	17	569	CpOGAD298N in complex with hOGA-derived S-GlcNAc peptide [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	8.82e-97	3	608	1	597	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.21e-96	3	608	1	597	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q89ZI2	3.29e-93	131	743	99	717	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
P26831	1.27e-80	3	948	1	1003	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	4.54e-35	192	513	63	385	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.998917	0.000217	0.000198	0.000179	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001304_00902.