CAZyme Information: MGYG000001304_01647

Basic Information

• Species: Erysipelatoclostridium spiroforme
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium spiroforme
• CAZyme ID: MGYG000001304_01647
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		39049.92	4.1795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001304	2507485	Isolate	not provided	North America

• Gene Location: Start: 368057; End: 369097 Strand: +

Full Sequence      

MKLNKVLLSLVMTMSLATGMIGTTSVNAIDGYISDDDLSDTQTDVPKAWGVTPTNEQYRY
QKEELAGFVHFGPNTFNEIEWGENYGDQTPDEIFRLEKDFDAKTLVKAFKDAGFKKIIVT
AKHHDGFCIWNSQYTDYDVASTSYKNGDGDILAEISEECSKYDIDMGLYLSPWDIHAPSY
GYYDENGNPTTADKDVLDYNDYYVNQLNEILGNDKYGNNGHFTEIWMDGAKGSGANAQEY
DFKRWYNTIQSQEGEEAGFDSECMIFQCGANTTVRWIGNENGYAAKDTWSKSNVNVEADT
CDDNMQGSYSVGYENGNKWTVPEADARITSGWFWGTKKIRLKVLLI

Enzyme Prediction     

No EC number prediction in MGYG000001304_01647.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	54	336	2.6e-46	0.7138728323699421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.01e-43	48	289	1	233	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	1.67e-24	72	250	52	223	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	1.84e-22	98	229	82	201	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PLT74914.1	2.23e-145	22	338	34	353
QPK81604.1	2.27e-143	29	338	29	344
QHB23055.1	1.06e-141	22	338	34	354
QEI30547.1	1.06e-141	22	338	34	354
QRT29448.1	1.48e-141	22	338	34	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TR3_A	1.38e-157	32	338	8	315	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]
6TR4_A	2.25e-156	32	338	8	315	Ruminococcusgnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1],6TR4_B Ruminococcus gnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1]
6ORG_A	3.70e-71	47	334	5	266	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	5.58e-70	47	334	5	266	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	5.73e-70	47	334	5	266	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	6.47e-58	53	334	38	287	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.60e-48	53	334	40	288	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	7.27e-08	76	191	82	195	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000432	0.998727	0.000229	0.000229	0.000195	0.000177

TMHMM  Annotations     

start	end
7	29