CAZyme Information: MGYG000001306_00046

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_00046
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		45060.98	6.6313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 12280; End: 13461 Strand: +

Full Sequence      

MKKVTHYIYSIACCLIIFLTQQSFASQPEYSTAGFFELPNTGRTVYSMNPAWRMYKDHLE
GAEQPDFNDKEWDLISLPDGIEYVPSEASGCVNYQGEVWYRKHFTPEETWKGKQLFLHFE
AIMGKAKVWINGTLVNEHYGGFLPVIANVTEYLNYEEDNVIAVWADNSNDPSYPPGKPQD
MLDFTYSGGIYRDCWMIVHNNVFITDPNYENETAGGGLFVSFGHISQSQSEIRLDAHVRN
SSNTYFSGKIEYQLFDKDNRRVCQASKAFSVSKGKARNTSLTIKVEKPELWEPDSPYLYQ
LHVLLKDKSGHIVDGYRRRIGIRSIEFKGKDGFWLNGKPYPYPLIGANRHQDFAISQIAF
IGEMQRNCAMQVSGSSAMHTIRRFLPLWMLAMS

Enzyme Prediction     

No EC number prediction in MGYG000001306_00046.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.06e-37	43	352	10	302	beta-D-glucuronidase; Provisional
COG3250	LacZ	4.62e-31	37	355	4	313	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	7.29e-31	24	350	52	342	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	9.68e-17	224	323	11	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	5.26e-14	72	193	40	162	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ42839.1	4.36e-191	25	355	27	357
BCA49329.1	1.12e-188	27	355	29	357
QUT70328.1	2.24e-188	27	355	29	357
QMW86990.1	2.53e-187	27	355	29	357
AAO79789.1	2.53e-187	27	355	29	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5UJ6_A	6.39e-43	25	366	7	337	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D8G_A	3.00e-42	36	366	24	345	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
6D50_A	4.07e-42	36	366	24	345	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6HPD_A	3.83e-41	38	338	30	339	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
5T98_A	2.11e-37	47	338	29	305	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	1.12e-45	42	369	2	309	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	2.09e-40	38	338	21	330	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.87e-29	49	338	48	325	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P26257	5.91e-28	43	353	2	294	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
P05804	1.12e-24	93	352	62	298	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.998953	0.000253	0.000153	0.000151	0.000150

TMHMM  Annotations     

start	end
7	26