CAZyme Information: MGYG000001306_00479

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_00479
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		37507.06	8.3061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 41187; End: 42167 Strand: +

Full Sequence      

MNLTISTHTPVRFSIIIMLLATCLPIGITPIAAQGFFSTTALTYSCQDIPQSIMFCGENI
DLTRFDRRERIDRELLAFTYMHSTSIQMIKRANRYFPIVESILQENGIPDDFKYLMSIES
NNNPLARSGAGAAGLWQFMPGTGREFGLEVGHSVDERYHVEKSTRAACKYLKQAYARFGN
WVSVAASYNAGQGRISRELERQYEEDALDLQLVEETARYVYRILAAKIMFSNPQKFGFRL
RACDLYPIIPYHEIKVEESIDDLPRFAKGRGITYSLLRNMNPWIRSSSLPVHGKNVYYIR
IPDKEGMHYNPRIIIPHDPRWVIKDE

Enzyme Prediction     

No EC number prediction in MGYG000001306_00479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	95	226	4.2e-26	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.02e-64	103	228	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.65e-26	109	206	12	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	1.01e-25	68	304	81	313	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	8.25e-25	115	226	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.16e-19	95	225	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36030.1	8.07e-178	38	323	38	323
QRO24006.1	1.18e-160	42	322	40	320
QEW35083.1	5.15e-143	40	324	48	332
QQY40386.1	5.15e-143	40	324	48	332
AND21743.1	5.15e-143	40	324	48	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	9.90e-11	65	253	407	607	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	9.92e-11	65	253	407	607	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	9.93e-11	65	253	408	608	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.01e-10	65	253	436	636	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	5.83e-26	68	306	78	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	5.83e-26	68	306	78	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31976	6.75e-06	119	225	1447	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	6.75e-06	119	225	1447	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.056698	0.691834	0.247745	0.002233	0.000748	0.000710

TMHMM  Annotations     

start	end
13	35