CAZyme Information: MGYG000001306_01058

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_01058
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	MGYG000001306_22|CGC1	61358.59	5.8459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 34151; End: 35779 Strand: -

Full Sequence      

MKNTNLKKCFTASLLGIIALGGYAQVNYVEPPIMGWSSWNTYRVNINEELIKKQADAMIS
QGLDKVGYHFINIDDGFFGFRDEKGILHTHPQRFPNGMKGIADYIHSLGLKAGIYSEAGA
NTCGSLWDGDKNGIGVGLYGFEHQDANLFFNEWGFDFIKTDYCGAGQQLDLEEQERYTEI
VNAIREVCPRNISLNICRWAYPGTWVSSLARSWRISGDINPSWESVKYIIDKNLYLSAFA
GNGHYNDMDMLEIGRGLKPEEEETHFGMWCIMSSPLLIGCDLTAIPASSLQLLKNKELIA
LNQDPLGLQAYVVQHEHRGYVLVKDIEEKRGTVRAVALYNPTEETCSFRVPLSVLELEGT
TRIRDLVKQKDERSVTDFIQFDVLPHGTKILRVEGERRMKPTRYEAEQAYLNQFDDLGKR
KRGIAFMPFETASGGMTITNLGGHKDNYAQWNEVFSEQGGTYQMTVQYIPAEKKEREISD
RRLEVTVNGNMTVVDKLETDRSKGVAQTTFTVNLQKGYNVIRIGSRFSWSPDLDCFTLTP
VK

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	137	371	3.6e-68	0.9737991266375546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14792	GH27	1.10e-120	32	304	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02808	PLN02808	2.99e-86	32	390	32	380	alpha-galactosidase
PLN02229	PLN02229	1.07e-85	6	390	33	414	alpha-galactosidase
PLN02692	PLN02692	3.51e-74	29	316	54	331	alpha-galactosidase
pfam16499	Melibiase_2	7.70e-62	32	304	2	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO26425.1	2.14e-311	21	538	7	524
QJR69910.1	5.36e-260	5	542	2	534
QJR74242.1	5.36e-260	5	542	2	534
QJR61495.1	5.36e-260	5	542	2	534
QJR65648.1	5.36e-260	5	542	2	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAS_A	6.39e-73	32	390	9	356	ChainA, alpha-galactosidase [Oryza sativa]
6F4C_B	1.61e-64	32	390	9	357	Nicotianabenthamiana alpha-galactosidase [Nicotiana benthamiana]
3A21_A	1.99e-62	25	395	6	385	CrystalStructure of Streptomyces avermitilis beta-L-Arabinopyranosidase [Streptomyces avermitilis],3A21_B Crystal Structure of Streptomyces avermitilis beta-L-Arabinopyranosidase [Streptomyces avermitilis],3A22_A Crystal Structure of beta-L-Arabinopyranosidase complexed with L-arabinose [Streptomyces avermitilis],3A22_B Crystal Structure of beta-L-Arabinopyranosidase complexed with L-arabinose [Streptomyces avermitilis],3A23_A Crystal Structure of beta-L-Arabinopyranosidase complexed with D-galactose [Streptomyces avermitilis],3A23_B Crystal Structure of beta-L-Arabinopyranosidase complexed with D-galactose [Streptomyces avermitilis]
4OGZ_A	1.66e-57	32	368	100	447	Crystalstructure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]
3A5V_A	5.66e-56	32	392	9	389	Crystalstructure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RX86	1.45e-74	32	390	40	388	Alpha-galactosidase 2 OS=Arabidopsis thaliana OX=3702 GN=AGAL2 PE=1 SV=1
Q55B10	2.95e-74	12	391	6	379	Probable alpha-galactosidase OS=Dictyostelium discoideum OX=44689 GN=melA PE=3 SV=1
B3PGJ1	3.60e-74	30	393	31	401	Alpha-galactosidase A OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agaA PE=1 SV=1
Q8VXZ7	1.77e-73	22	371	61	404	Alpha-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=AGAL3 PE=1 SV=1
Q9FXT4	1.65e-71	32	390	64	411	Alpha-galactosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os10g0493600 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000857	0.998148	0.000373	0.000214	0.000193	0.000187

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_01058.