CAZyme Information: MGYG000001306_01709

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_01709
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		41031.57	8.7675

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 33473; End: 34540 Strand: +

Full Sequence      

MKNLILTAIAVCSLNTIQAQEISYKKWVKEAPRLEDSFFTTPKAKEVAETVLLYQQPTGG
WPKNINFFQTPDNKEKALEIKNDVNASTIDNGATTTEIIYLSRLYNATHDETYKEAAIRG
LDYLFEAQYENGGWPQFYPRPKGYYVQITYNDNAMINVMNLLRDVSNGKSPFTYLPESTR
QKAQKAIDKGVECILKTQVKQHGKLTVWCAQHDRETFAPAKARAYELPSLSGAESANIVI
YLMQLTNPSAEVIQSIESAVQWFKDSEIKGIKIESFINKDGKKDRRVAPCEDCKPMWARF
YELETNRPFFCDRDGIKRYHLSEIGYERRNGYSWLNRSGENVYKEYAQWQKRIRK

Enzyme Prediction     

No EC number prediction in MGYG000001306_01709.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	55	341	3.6e-123	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	1.36e-156	55	342	1	288	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	3.15e-147	55	342	1	289	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
TIGR01787	squalene_cyclas	0.003	40	153	507	609	squalene/oxidosqualene cyclases. This family of enzymes catalyzes the cyclization of the triterpenes squalene or 2-3-oxidosqualene to a variety of products including hopene, lanosterol, cycloartenol, amyrin, lupeol, and isomultiflorenol.
cd04792	LanM-like	0.006	72	134	570	634	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT78007.1	2.72e-172	1	355	1	364
QRN00268.1	1.13e-159	23	351	30	360
QUT25428.1	6.49e-159	23	351	30	360
QGT71946.1	6.49e-159	23	351	30	360
QDM09637.1	9.21e-159	23	351	30	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	5.82e-68	37	352	76	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	9.71e-66	48	342	37	322	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	1.52e-64	48	342	37	322	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000280	0.999046	0.000197	0.000159	0.000148	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_01709.