CAZyme Information: MGYG000001306_02072

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_02072
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		26833.47	5.7549

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 33; End: 719 Strand: +

Full Sequence      

MLCCVFGVFAQKDITYWNKMANGTSEALIKHFWGASFEGYEKRYYFNYGSDLSDMSTNNY
WPQAHAMDVLVDAYMRTGKSYYKELFPLWWEGMPKYNFAGKMNPKDPWWNVFVDDMEWIV
LAQIRMFESTGEKKYIEKARQVYDDWIWPTWGPEDEAPWFGGITWKTDVAKSKNACSNGP
AALIAARLYSFYDQAQFSDGKIKNAYLNEAIKIYIWEKNYLSLIPQHN

Enzyme Prediction     

No EC number prediction in MGYG000001306_02072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	20	221	6.3e-40	0.5307262569832403

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	1.20e-17	17	216	3	177	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	6.41e-17	16	216	1	185	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO76990.1	9.54e-123	10	221	37	246
QUT39865.1	9.54e-123	10	221	37	246
QMW88830.1	9.54e-123	10	221	37	246
QQA09722.1	9.54e-123	10	221	37	246
QUT72195.1	9.54e-123	10	221	37	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.20e-23	33	221	54	228	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.00e-22	33	221	55	229	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.04e-21	33	221	55	229	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
5M77_A	1.91e-13	1	222	21	220	ChainA, Alpha-1,6-mannanase [Niallia circulans],5M77_B Chain B, Alpha-1,6-mannanase [Niallia circulans]
4BOK_A	3.11e-13	59	222	37	186	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.811575	0.187057	0.000560	0.000382	0.000175	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_02072.