CAZyme Information: MGYG000001306_02117

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_02117
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		26267.61	6.4669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 1650; End: 2360 Strand: +

Full Sequence      

MLKSENIICRNIRYDAKLVNNDGIDPEYTRNLLIENIEFNNGDDNVAIKCGRDNDGWNTN
RPSENIIIRNCKFKGLHGVVLGSEMSSGVQNIFIENCTYGGYCKRGIYMKTNPDRGGFLR
NIYVNNCQFGEVEDLFYVTSMYAGEGMDNNHYSEVCNIYVKDISCKKASAAAIVLQGTLA
KPIHHVTFENVNVDKAGIGLSFSNTETISIKNCNLGGYVGIPSTASQKDNLFNKDK

Enzyme Prediction     

No EC number prediction in MGYG000001306_02117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	3	213	1.4e-43	0.5969230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.68e-31	1	204	266	463	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	7.17e-07	20	194	137	304	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	8.92e-07	20	149	187	308	Probable polygalacturonase At3g15720
PLN02218	PLN02218	1.27e-05	20	193	241	408	polygalacturonase ADPG
PLN02155	PLN02155	1.51e-04	6	193	178	363	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY35504.1	3.26e-150	1	234	229	462
AND21958.1	6.59e-148	1	234	210	443
AII62903.1	1.37e-147	1	234	232	465
QUT83816.1	1.37e-147	1	234	232	465
QJR67967.1	1.37e-147	1	234	232	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	3.90e-33	8	229	235	452	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	7.68e-26	4	163	221	381	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	2.69e-15	4	196	230	427	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	4.23e-12	20	117	71	170	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P20041	6.47e-10	20	194	282	455	Polygalacturonase OS=Ralstonia solanacearum OX=305 GN=pglA PE=1 SV=1
P58598	1.72e-08	20	194	284	457	Polygalacturonase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=pglA PE=3 SV=1
A2QG68	3.26e-06	20	197	208	394	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_02117.