CAZyme Information: MGYG000001306_02503

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_02503
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000001306_56|CGC1	45790.26	5.3231

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 17760; End: 18947 Strand: +

Full Sequence      

MKNQILILFIGCLFIFSGCHKVKHESDFASYAMTLMDSTLMYYKVPGQVLFYETYPKRDA
DLVTYLAGADTIRKNRVAYLWPTSGMFSALNALQKTTGDKKYENMIESVILPGLECYFDS
LRVPGCYQSYLTESGKSDRFYDDNLWLGLDFLDLYEQTGNDAYLASARNIWSFIESGCDS
ILGGGVYWCEQKKESKNTCSNAPAAVLALRLYSLTKEKHFFRMGQDLYYWTKKNLQDPAD
FLYFDNITLDGSVNRTKFQYNAGQMLQASVLLYNLTKENLYLEEAQRLASACGQYFFEDF
VAEDGESFKAIKNGNVWFVVIMLRGFEELYKVDRNPVYLNSFKKTLQYMWEHNPNQNMLF
DDDCFVEKRSESKDTKWLLTQAAMIEMYARLSKIK

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	73	363	2.9e-68	0.7877094972067039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	7.01e-37	79	299	34	258	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	2.99e-14	137	311	88	269	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	0.004	81	244	29	174	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73400.1	6.39e-143	1	395	1	395
QQA08572.1	6.39e-143	1	395	1	395
QIK59395.1	1.95e-142	1	394	2	396
ALJ44514.1	1.04e-141	1	395	1	395
QIK53946.1	2.24e-141	32	394	36	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	3.52e-97	28	393	4	364	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	3.19e-59	78	395	43	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	9.14e-58	32	392	132	492	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4V1S_A	2.36e-28	127	349	127	346	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	5.09e-26	127	349	127	346	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000072	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_02503.