CAZyme Information: MGYG000001306_02513

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_02513
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000001306_56|CGC1	27909.87	6.7111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 33246; End: 33959 Strand: +

Full Sequence      

MKKTLTILFMLCCVFGVFAQKDITYWNKMANGTSEALIKHFWGASFEGYEKRYYFNYGSD
LSDMSTNNYWPQAHAMDVLVDAYMRTGKSYYKELFPLWWEGMPKYNFAGKMNPKDPWWNV
FVDDMEWIVLAQIRMFESTGEKKYIEKARQVYDDWIWPTWGPEDEAPWFGGITWKTDVAK
SKNACSNGPAALIAARLYSFYDQAQFSDGKIKNAYLNEAIKIYIWEKNYLSLIPQHN

Enzyme Prediction     

No EC number prediction in MGYG000001306_02513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	230	7.2e-40	0.5307262569832403

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	9.24e-18	26	225	3	177	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	3.72e-17	25	225	1	185	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO76990.1	6.78e-123	19	230	37	246
QUT39865.1	6.78e-123	19	230	37	246
QMW88830.1	6.78e-123	19	230	37	246
QQA09722.1	6.78e-123	19	230	37	246
QUT72195.1	6.78e-123	19	230	37	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.51e-23	42	230	54	228	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.77e-22	42	230	55	229	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.55e-21	42	230	55	229	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
5M77_A	6.89e-14	5	231	16	220	ChainA, Alpha-1,6-mannanase [Niallia circulans],5M77_B Chain B, Alpha-1,6-mannanase [Niallia circulans]
3K7X_A	2.81e-13	26	230	3	186	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000275	0.999072	0.000214	0.000153	0.000144	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_02513.