CAZyme Information: MGYG000001306_02705

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_02705
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		77001.42	5.6476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 154017; End: 156050 Strand: -

Full Sequence      

MKITMRIHALCFILGIILSATSIRAEEERLWQLHAVDIQAPYAPAPMANGCIGILPQKEP
FAVEHVMLNHVFDAASPHVVSRVMRGINPFCLSMKIDNKKVDTSNISDWQQTIDMRRAVH
QTSFQTLEKADVSYELCALRNLPYAGLIRVTVQACKDMLLEVRSGMGIPDDYSQSSIRHR
EMEADGNRMYMLESDATSRFGYRRVASTSSFLFNGEQIKPMYDEATRELFFSIQLKKGET
FCFSLVGSVCSSRDFFDPYNEAERQVIYAVHEGEEALMQAHYRLWDELWQGDIRIEGDDD
AQRIVRFALFNLYSSCRGGSRLSIPPMGLSLQGYNGHIFWDTELWMYPPMLLLNQDIARS
MLDYRFDRLPAARKKALAYGYRGAMFPWESDDSGEEATPTHALTGPFEHHITADIGIACW
NYYCVTRDMRWLQREGYPLLKEIADFWASRVTRNQDGSYSIHNVTGADEYANGVTDNAFT
NGAASLALKYACQAAEICGEKVPEIWREIGENIRILQFENGVTREHSTYKGEMIKQADAN
LLAYPLGVITDEYRQRQDLEYYAERIDQKDGPAMSYSVYCVQYARMGEADKAYEMFRRCY
EPNLKKPFGVISETPTSNNPYFMTGAGGLLQAVLNGFCGLQITDEGIVQLPSALPSHWKR
VTVTGVGSDKKTYVRER

Enzyme Prediction     

No EC number prediction in MGYG000001306_02705.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	306	644	4.9e-107	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	8.11e-112	96	661	91	718	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	9.55e-69	306	647	1	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	8.87e-50	77	598	75	651	maltose phosphorylase; Provisional
COG3459	COG3459	0.006	584	664	907	1005	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17389	Bac_rhamnosid6H	0.009	417	598	105	291	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37608.1	0.0	11	675	13	672
QUT91743.1	0.0	5	677	1	674
QRQ48989.1	8.12e-295	13	677	7	671
QIU93251.1	2.49e-293	27	675	22	667
CBK67144.1	2.31e-286	8	675	2	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.12e-199	24	674	17	675	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	2.02e-58	47	659	27	712	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	7.63e-39	77	670	75	718	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTR_A	1.60e-34	231	666	225	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTP_A	2.85e-34	231	666	225	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	1.42e-81	232	656	210	644	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q8L163	9.53e-62	263	662	282	733	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
A0JMP0	6.38e-59	234	666	148	585	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
F1NZI4	2.16e-56	254	666	209	637	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q8RBL8	5.24e-56	260	662	276	730	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000344	0.998974	0.000199	0.000169	0.000151	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_02705.