CAZyme Information: MGYG000001306_03049

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_03049
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	MGYG000001306_60|CGC3	61600.1	5.6587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 246225; End: 247841 Strand: -

Full Sequence      

MLKPVCIKVGLTLFAGACLCGEIQAHSLNGEKEDILNTMKSATRYMMDSVSYRGGFVWNY
LPDLSRSWGEMEAKRTMVWIQPPGTPSVGHLLLDAYHATGDEFYYEAAEKVANVLIWGQL
ECGGWNYVFDFAGENSLKEWYETVGKSGWRLEEFRHYYGNATYDDLGTISAAKFLLRMYV
EKNDPAYKVPLEKVIHFILESQYPVGGWPQRYPLRYDHPFEGKEDYSSFITLNDDVTPEI
IDFLIQCYQAMGLQNIKEPIMRAMYLTITLQQGEPYAGWADQYTVTDLKPAHARSYEPRS
VNTGTTVGMIYQMMEYYKLTADTRFLSGIPAAIKFLESQKLPETEVRKWHRKSDNPDEIL
VPRFIDPDTGKPLYVHRKGGNIYNGKYYIDQNIENTIAHYSSATFVNPEQLRKDFDEVKK
IDKNKLLSQSPLLSDELCPLPKYYTHCPRLVTEKEISNLMAQVKKQGYWLSDLPSTSHPY
RCGWTPDLSGKEDYSRKMVGDDFDTSPYPCTDGQQCISVAAYIKNMMALIAALEGNVK

Enzyme Prediction     

EC	4.2.2.2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	119	402	5.9e-131	0.9963636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02474	pec_lyase	9.51e-22	119	379	1	262	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam09492	Pec_lyase	1.93e-21	119	383	1	265	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
cd04434	LanC_like	0.006	84	200	3	134	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY38157.1	9.03e-298	1	534	1	536
QJR66990.1	4.00e-292	33	534	35	536
QJR71330.1	4.00e-292	33	534	35	536
QUT87327.1	4.00e-292	33	534	35	536
QJR62731.1	4.00e-292	33	534	35	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	3.32e-13	106	377	81	368	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	3.74e-11	112	384	37	300	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	3.79e-10	112	384	37	300	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000543	0.661836	0.336818	0.000281	0.000259	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_03049.