CAZyme Information: MGYG000001306_03070

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_03070
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		35906.18	9.4655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 274960; End: 275871 Strand: -

Full Sequence      

MSIIFSLIKKVTYALCESLFCWRRPSHPILYMTLLVKNEEELLEQNLIFHKQMGVDGFIV
TDNNSTDHTPDILRKYKELGWIKEIIQEPATDYRQKKWVDRMVWCAKTVFHADWVINADA
DEFWYAPSGNLKSGLKHVSDNVIKCAIRNMYPEEGKSFREWKYVVDPVTDTDKYDLSPYS
LFGRQIPKVMHRTRGYIRISMGNHKVAMFPKRSGKSDIRIYHYNIRGRQQFLEKMINGGK
QLEQNPSKHGGRHWRYFYGLYKEGKLNEEYDRVIGSRVFDRLQADGYIHEDHTMADFFKN
LNK

Enzyme Prediction     

No EC number prediction in MGYG000001306_03070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	37	131	1.9e-17	0.9479166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13704	Glyco_tranf_2_4	1.05e-14	37	128	1	89	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,
cd02511	Beta4Glucosyltransferase	2.45e-06	34	235	6	176	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam01697	Glyco_transf_92	2.84e-05	49	226	26	208	Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily.
cd00761	Glyco_tranf_GTA_type	0.003	35	125	4	91	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT86533.1	5.56e-141	7	302	5	300
QJR78861.1	6.92e-140	7	301	5	299
QJR57912.1	9.83e-140	7	301	5	299
AII67364.1	9.83e-140	7	301	5	299
QJR57294.1	9.83e-140	7	301	5	299

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999828	0.000201	0.000019	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_03070.