CAZyme Information: MGYG000001306_03272

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_03272
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000001306_67|CGC1	29754.96	8.1505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 34973; End: 35725 Strand: +

Full Sequence      

MVENVVEHSKFVDIMPPKIIHLCWFSKDPYPLEIKICLASWKRVLPDYKVRVWTYEDAKA
IGCKYIDQALSVRKWAFAADVVRFYAVYKEGGVYMDSDIYLRKRFDRFIPETGCATFNER
WEEGETDYGIQAAFFIGSKGNDFCKEVFEYYQERDFIRPDGSLDQTISPYIMRSVAERRG
YVCKEEEQHLDGIHIYPTHWLSPRSRFKHSPDAFGEHRVYGSWRDHKFGRKLERSFKHFC
NAVRFYLLGR

Enzyme Prediction     

No EC number prediction in MGYG000001306_03272.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	35	111	9e-17	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	4.43e-10	17	111	83	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	4.88e-08	17	155	47	196	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam04488	Gly_transf_sug	7.78e-08	40	112	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49969.1	7.92e-104	15	250	1	232
AVM58066.1	7.50e-102	15	250	1	232
AVM53007.1	2.03e-99	15	250	1	232
CBK68805.1	8.24e-45	15	239	1	243
QUR43722.1	8.24e-45	15	239	1	243

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_03272.