CAZyme Information: MGYG000001306_03289

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_03289
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000001306_67|CGC3	34837.49	8.608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 61338; End: 62249 Strand: -

Full Sequence      

MTYAPILLFVYNRPEHTRQVVSSLLHNKEAADSPLFIYADQSKNPESDAAVQEVRRYIHS
ISGFKTITIIERETNWGLARNIIDGVTTQVNHFGRVIVLEDDLIVAPYFLKFMNDALEVY
KDEQRVGHIQACDFTKDISLPDTFLIKWTGSWGWATWSRAWKHFNPDGKELLAQLEARNL
TRYFDFNGNYPFTRMLRRQIEGKNNSWAIRWNASLFLADILSLNVGKSLIQNTGFDGSGT
NCGGGGLYDSTLWQQPLPVTLISPTEENQTARKVFERYYHQTNCFWAKAIRRIKRTLKGD
FGA

Enzyme Prediction     

No EC number prediction in MGYG000001306_03289.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02514	GT13_GLCNAC-TI	8.04e-05	4	113	2	118	GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GLCNAC-T I , GNT-I) transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide, an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus. The catalytic domain is located at the C-terminus. These proteins are members of the glycosy transferase family 13.
pfam03071	GNT-I	1.00e-04	1	112	92	211	GNT-I family. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC:2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus, and is probably distributed in all tissues. The catalytic domain is located at the C-terminus.
pfam00535	Glycos_transf_2	6.55e-04	10	200	6	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36898.1	2.28e-182	3	303	2	302
ANV98023.1	1.67e-87	4	298	7	304
ATY34291.1	1.26e-82	4	272	6	273
ACH39575.1	2.96e-81	1	283	1	282
ABZ94462.1	7.96e-81	1	242	1	243

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000011	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_03289.