CAZyme Information: MGYG000001307_00074

Basic Information

• Species: Providencia stuartii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia stuartii
• CAZyme ID: MGYG000001307_00074
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	MGYG000001307_2|CGC2	72844.03	9.108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001307	4603561	Isolate	not provided	not provided

• Gene Location: Start: 85910; End: 87826 Strand: +

Full Sequence      

MKKFLMAVPIAMMLVSTTVWADSLQAQRERYQAIKQAWDAKQMDEVERLLPTLQTYPLYP
YLEYRELTQDLDIISPSQVQAFIDAHPTLPVAKTLKNRFVNELARRQEWQSLLAFSPKEP
MPAEAKCNYFYANWATGNKTLAWQGAEKSWLNGRSMPAACDKLFNEWEKAGHLTPEMILE
RIHLAIDAGNTSMATYLAKRLPPSYRTIGDALVKLQNDPASVTTFAKTMTPTDFSRQATI
AAFSRYARQSPDQARAALKGISNAQKMNFVETQKLKDSVAWQYMGAVTPEQENWRDEVIS
ETDSTALKERRIRLALGAGDKAGVAKWLKQLPADARHKDEWQYWQAITLMNEGKKAEGEA
ILRKLIEGRGFYPMVAAQKLNTEYPLYIKTAEKPDSQQLDKLAEIQRVRELMYWEMDNLA
RTEWVSLVASLPPNQQEQLARYAFDNNWADLSVQATIQAKLWNHLEERFPLAWEKEFEHY
TKGKTISKSYAMAIARQESAWNPQAKSPVGATGLMQLMPATAKHTVQKQRIDGYVNTSQL
VNPVKNIEIGTAYLDDVYQQFSNNRILSSAAYNAGPSRVTRWLGNSSGRLDAVAFVESIP
FSETRGYVKNVLSYDVFYRYFMGQHGPVLTDNEWLMKY

Enzyme Prediction     

No EC number prediction in MGYG000001307_00074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	489	614	4.3e-29	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	1	638	1	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	2.93e-67	468	620	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	8.58e-46	367	631	23	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	1.88e-37	470	614	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	6.75e-35	480	593	4	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV10041.1	0.0	1	638	1	638
QUC25193.1	0.0	1	638	1	638
QPN41149.1	0.0	1	638	1	638
AVE41087.1	0.0	1	638	1	638
QIB28815.1	0.0	1	638	1	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.56e-255	22	638	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	5.14e-254	22	638	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	5.70e-91	19	633	22	636	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	3.85e-90	53	633	27	607	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.14e-89	53	633	27	607	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	4.15e-257	5	638	11	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	4.15e-257	5	638	11	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	3.16e-254	21	638	27	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	3.76e-74	218	637	175	591	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	3.11e-14	486	613	73	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.998984	0.000193	0.000176	0.000171	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001307_00074.