CAZyme Information: MGYG000001307_02109

Basic Information

• Species: Providencia stuartii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia stuartii
• CAZyme ID: MGYG000001307_02109
• CAZy Family: GH18
• CAZyme Description: Chitinase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		36514.09	4.6521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001307	4603561	Isolate	not provided	not provided

• Gene Location: Start: 677961; End: 678956 Strand: -

Full Sequence      

MSSDNIINTQVVDDAAAMPDISNKKIMMGFWHNWAAGASDGYQQGQCANMNLTDIPEEYN
VVAVAFMKGEGIPTFKPYNLSDAEFRRQVGVLNSQGRAVLISLGGADAHIQLKTGDEDKL
TNEIIRLVETYGFDGLDIDLEQTAISSANNKTVLPAALKKVKEHYAAEGKNFIISMAPEF
PYLRINGAYLDYINALEGYYDFIAPQYYNQGGDGIWVDETTSGKGAWLTQNSDAMKEDFL
YYLTESLVTGTRGYTKIPPSKFVIGLPANNDAAGSGYVIDKQAVYNAFARLDAKNLSIKG
LMTWSVNWDNGKSKTGVAYNWEFKTRYAALL

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	25	270	5.7e-27	0.6621621621621622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3469	Chi1	2.00e-172	13	331	15	329	Chitinase [Carbohydrate transport and metabolism].
cd02871	GH18_chitinase_D-like	9.75e-102	25	330	1	312	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
pfam00704	Glyco_hydro_18	2.29e-14	99	309	66	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	4.23e-11	29	326	4	300	Glyco_18 domain.
cd00598	GH18_chitinase-like	4.88e-09	96	209	64	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPN39074.1	8.21e-245	1	331	1	331
AXO20681.1	8.21e-245	1	331	1	331
AFH95576.1	8.21e-245	1	331	1	331
QIB30592.1	8.21e-245	1	331	1	331
QET96051.1	1.17e-244	1	331	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AXN_A	4.52e-213	1	331	1	327	Hallmarksof processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the Serratia marcescens chitinases [Serratia marcescens],4AXN_B Hallmarks of processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the Serratia marcescens chitinases [Serratia marcescens]
3IAN_A	4.44e-132	21	331	1	310	ChainA, Chitinase [Lactococcus lactis subsp. lactis]
4W5Z_A	1.48e-116	26	327	32	334	Highresolution crystal structure of catalytic domain of Chitinase 60 from psychrophilic bacteria Moritella marina. [Moritella marina]
4HMC_A	4.69e-114	26	327	10	312	Crystalstructure of cold-adapted chitinase from Moritella marina [Moritella marina],4HMD_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction intermediate - oxazolinium ion (NGO) [Moritella marina],4HME_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction product - NAG2 [Moritella marina]
4MB3_A	1.33e-113	26	327	10	312	Crystalstructure of E153Q mutant of cold-adapted chitinase from Moritella marina [Moritella marina],4MB4_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag4 [Moritella marina],4MB5_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag5 [Moritella marina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S2	7.85e-139	9	331	25	347	Chitinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0361 PE=1 SV=1
P27050	6.75e-34	19	309	184	496	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
D4AVJ0	4.47e-23	52	309	17	313	Probable class II chitinase ARB_00204 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00204 PE=1 SV=2
E9F7R6	6.32e-21	25	315	41	336	Endochitinase 4 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi4 PE=3 SV=1
Q05638	2.53e-20	41	309	268	581	Exochitinase 1 OS=Streptomyces olivaceoviridis OX=1921 GN=chi01 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001307_02109.