CAZyme Information: MGYG000001308_00075

Basic Information

• Species: Streptococcus infantarius
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus infantarius
• CAZyme ID: MGYG000001308_00075
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000001308_1|CGC3	55572.24	4.8903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001308	1925087	Isolate	not provided	not provided

• Gene Location: Start: 73989; End: 75422 Strand: -

Full Sequence      

MYTKEEYAKDCQIHNDMRRLVDSDVNRLNYHLMAPAGWLNDPNGLVEKNGINHVYFQYTP
FDAGWGIKSWGHYTTKDWLTYKEEEPFVFADNRLDRDGAYSGSAIVKDGIIHYFYTGNVK
LLDGDYDYILTGREQNTIHLTSSDGFHFSGKELVLANSDYPDDMTTHVRDPKILKDGEKY
IMVLGARSIEDKGCALVYHSTDLSHWHYVTRIQTSEKFGFMWECPDLFKLGNQLILSVSP
QGLEKEEARYQNVFQSGYFLVDENHGDYTVRKFEEFDYGFDFYAVQTFEDESGRRILMAW
MGLPMESEYQEDPTVKYNWRHALTMPRELVFQNGAVYQRPLKEFEKLRKNEFQSQISEFT
QWQTENCCFEINVTFSNPAESFSLRLRDDVILTFDGSLLSLKMGESGFGRTQRNIALDKV
SRLQFFSDTSSIEIFINGGRYTMTSRVFSDTLKQIITFDSKSDGQLTIYDLKKFNIE

Enzyme Prediction     

No EC number prediction in MGYG000001308_00075.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	31	340	4.2e-86	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.16e-148	37	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	4.10e-135	17	450	4	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	5.62e-126	27	473	29	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	9.13e-104	31	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	3.89e-101	31	439	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK29386.1	0.0	1	477	1	477
QIX73692.1	0.0	1	477	1	477
SQI07836.1	0.0	1	477	1	477
QCE36117.1	0.0	1	477	1	477
ALT82805.1	0.0	1	477	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	6.72e-68	30	477	29	486	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	3.85e-58	2	466	3	482	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	1.55e-54	27	450	49	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.20e-53	27	450	49	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	5.25e-43	29	472	5	428	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.96e-95	20	468	22	473	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	1.58e-80	2	472	4	490	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	1.56e-77	2	455	13	460	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P16553	3.80e-76	30	467	27	468	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
A1STJ9	5.91e-75	27	459	96	525	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999653	0.000397	0.000012	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001308_00075.