CAZyme Information: MGYG000001308_01213

Basic Information

• Species: Streptococcus infantarius
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus infantarius
• CAZyme ID: MGYG000001308_01213
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		34403.19	5.1422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001308	1925087	Isolate	not provided	not provided

• Gene Location: Start: 52791; End: 53747 Strand: +

Full Sequence      

MKKTLIGSLTALTVLSGIVAAYEVKADAIISGNTYKITAKHSGKVLDVARGAKTASANVQ
QWNDTNGTNQKWTVVDTGDGYYKLVSENSGKVLDVASAATYDGANVQQWDDTNGTCQRWK
IIDAGNGYYKLISAVSGKALDVAYGDTKAGANVQQWYETGGDNQKWQFTKVDESHNTGSN
TGSDTPVATAGFHTSGTTLYDAKNQPFVMRGINHPYVWYQGYEETAIPAIAKTGANCIRI
VMGDGQQYSKTSLAEIQKLLQLCKDNHLIAIVEAHDATGSDNIQDLENAANYWMEMKEAL
IGNEDHVILNIANEWAGS

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	201	318	1.6e-42	0.4743083003952569
CBM13	33	178	2.1e-34	0.7340425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14200	RicinB_lectin_2	5.65e-34	68	156	1	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	1.61e-27	30	109	10	89	Ricin-type beta-trefoil lectin domain-like.
pfam00652	Ricin_B_lectin	1.28e-18	34	166	2	126	Ricin-type beta-trefoil lectin domain.
pfam14200	RicinB_lectin_2	1.21e-15	115	172	1	58	Ricin-type beta-trefoil lectin domain-like.
cd00161	RICIN	6.13e-15	42	168	9	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGW99981.1	1.51e-120	1	318	1	313
VED90612.1	1.72e-109	1	318	1	316
VTS81291.1	1.72e-109	1	318	1	316
VEE21077.1	3.81e-109	1	318	1	222
QGX44134.1	1.96e-108	1	318	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WHJ_A	1.33e-47	190	318	1	129	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
3JUG_A	2.39e-47	187	318	20	151	Crystalstructure of endo-beta-1,4-mannanase from the alkaliphilic Bacillus sp. N16-5 [Bacillus sp. N16-5]
2WHL_A	1.01e-46	191	318	1	128	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
1WKY_A	8.08e-46	188	318	6	136	Crystalstructure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module [Bacillus sp. JAMB-602]
1BQC_A	3.05e-27	191	318	3	132	Beta-MannanaseFrom Thermomonospora Fusca [Thermobifida fusca],2MAN_A Mannotriose Complex Of Thermomonospora Fusca Beta-Mannanase [Thermobifida fusca],3MAN_A Mannohexaose Complex Of Thermomonospora Fusca Beta-mannanase [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1K3N4	7.30e-47	190	318	1	129	Mannan endo-1,4-beta-mannosidase OS=Salipaludibacillus agaradhaerens OX=76935 PE=1 SV=1
B3PF24	5.04e-25	188	318	45	177	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=man5A PE=1 SV=1
P51529	3.59e-23	187	318	35	168	Mannan endo-1,4-beta-mannosidase OS=Streptomyces lividans OX=1916 GN=manA PE=1 SV=2
P22533	1.28e-14	211	318	55	166	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000240	0.999128	0.000162	0.000176	0.000157	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001308_01213.