CAZyme Information: MGYG000001309_02873

Basic Information

• Species: Clostridium_F botulinum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F botulinum_A
• CAZyme ID: MGYG000001309_02873
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000001309_2|CGC11	44432.57	8.2028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001309	4102125	Isolate	not provided	not provided

• Gene Location: Start: 1662038; End: 1663219 Strand: +

Full Sequence      

MSKIVFFSIPAHGHTNPTIAVVDELVKRGHEVWYYSFYEFQEKIETAGAKFIPCDNYLPE
LTPDIEKKVGKDFASLIEMAADMTMSLDEKVCRDLKEFQPHCIVSDSICIWGKLFAIKLN
VPYICSTTTFAMNKYTAKLIKQGLKEMFRMFIGIPRINKKIKLLQEKGYNVKNFISIIQN
DNDTDTIVYTSKEFQPMVETFSDKYAFVGPSFRVPEVEQIKKKYPLIYISLGTVLNQNRH
FYENCIKALGDVDCQVIMSVGEKADIFSLGKLPDNFKVYPKVEQLKVLQQTDVFITHCGM
NSISESLYFGVPSVLFPLHSEQAMVANRVAELNAGKRLKSDAVNSIPETVLQVLNDISYK
RNAEVISKSLRKAGGASAAANKIEKVCNESTTK

Enzyme Prediction     

No EC number prediction in MGYG000001309_02873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	11	385	1.6e-39	0.9397905759162304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	6.55e-100	7	385	1	388	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
COG1819	YjiC	1.11e-75	1	393	1	405	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	6.73e-70	3	380	2	399	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
cd03785	GT28_MurG	1.07e-14	13	379	11	344	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00201	UDPGT	8.14e-11	227	367	278	419	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ50845.1	1.17e-289	1	393	1	393
AVQ47477.1	1.17e-289	1	393	1	393
AVQ43352.1	1.31e-286	1	393	1	393
AVQ39844.1	1.31e-286	1	393	1	393
AVQ53320.1	1.07e-285	1	393	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	6.93e-61	4	384	6	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	7.89e-61	4	384	6	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
2IYA_A	2.63e-46	4	389	15	422	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3IA7_A	2.60e-36	4	384	7	394	CrystalStructure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora],3IA7_B Crystal Structure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora]
6J31_A	4.50e-36	4	385	7	392	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31853	1.01e-61	1	391	1	400	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O34539	4.32e-60	4	384	6	382	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
O05496	1.24e-55	1	372	1	375	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
Q65JC2	4.91e-55	4	384	6	387	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
Q9XC67	1.55e-39	1	384	58	454	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001309_02873.