CAZyme Information: MGYG000001309_03155

Basic Information

• Species: Clostridium_F botulinum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F botulinum_A
• CAZyme ID: MGYG000001309_03155
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000001309_2|CGC16	35918.43	9.9362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001309	4102125	Isolate	not provided	not provided

• Gene Location: Start: 1969079; End: 1970008 Strand: -

Full Sequence      

MKKITGLFLKLIILVLLVFTIFIIFNSLILNKTKERFLPENAMNIYIRAADEVSENKLQV
NWKYIAALDAVKNEGDFSKANIESAKTLGGSFLEISKNRKFKNTNYRLLTLDEVISKMSL
TEEEKKNVHKYLDKLNNIYPITPDEYKRQFIDELIPISKELYDEYGILPSITIGQAILES
DWGRSELSKKGNNLFGIKATPSWQGKVLNMETSENYKDKIKDNFRYYSSKEDSIKDYANF
LVKNKRYRENKVFRATEYKTQAKAIEKAGYSTKKDKDGNLLYSSLLGKIIREYNLQLIDS
KTQEKISRK

Enzyme Prediction     

No EC number prediction in MGYG000001309_03155.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	157	295	4.1e-36	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.92e-50	147	299	43	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	2.71e-27	149	291	154	295	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	3.05e-25	156	237	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	3.79e-23	149	295	162	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	7.86e-22	150	297	11	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ42815.1	3.59e-212	1	309	1	309
AVQ40152.1	3.59e-212	1	309	1	309
AVQ49910.1	4.19e-211	1	309	1	309
AVQ46417.1	4.19e-211	1	309	1	309
AUM95599.1	1.40e-209	1	309	1	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	1.03e-13	148	272	4	133	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.40e-13	148	272	4	133	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.45e-13	150	272	4	131	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	1.64e-13	146	299	29	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
2ZYC_A	1.74e-13	150	272	5	132	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.53e-24	150	299	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.97e-13	142	272	153	290	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P15931	1.45e-12	119	272	128	282	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q2G222	4.23e-12	97	301	255	474	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P75942	6.46e-12	148	272	150	279	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988515	0.006132	0.000519	0.000025	0.000018	0.004838

TMHMM  Annotations     

start	end
7	29