CAZyme Information: MGYG000001309_03717

Basic Information

• Species: Clostridium_F botulinum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F botulinum_A
• CAZyme ID: MGYG000001309_03717
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		55327.07	4.9572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001309	4102125	Isolate	not provided	not provided

• Gene Location: Start: 2609042; End: 2610487 Strand: -

Full Sequence      

MKTNFPENFLWGGAVAANQCEGAYNIDGKGLSVQDVAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLLGEMGFKVFRLSIAWSRIFPMGDEKEANEKGLQFYDDVFDECLKYGIQP
IVTLSHYETPLHLSKVYDGWKCREMIGFFNKYVCTVFNRYKNKVKYWLTFNEINSITHAP
FLSGGIYTPLEELSKQEIYQAIHHELVASATAVKACHEIIPDAKIGCMILGMPVYPMTPS
SEDMWETLNKERENFFFSDVQVRGYYPSYSKRFFKENNVKLDITHEDIEILKNTVDFISF
SYYMSICESSDKSIKPGEGNIIGGIPNPYLEASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELEDGTKIVLDDYRISYLRDHLIQVAEAIEDGVDLMGYTSWGCIDLV
SFTTSELKKRYGFIYVDRNDDGTGTLKRYKKKSFYWYKEVISSNGDIEALCSNISIEKDK
I

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	465	6.6e-148	0.9953379953379954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	2	466	3	475	6-phospho-beta-glucosidase BglA; Provisional
PRK09589	celA	0.0	3	466	2	474	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	2	470	1	459	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	2	468	3	478	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	2	465	1	470	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRI54759.1	0.0	1	481	1	481
CBZ03087.1	0.0	1	481	1	481
AJD30236.1	0.0	1	481	1	481
APQ68041.1	0.0	1	481	1	481
ACO85077.1	0.0	1	481	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IPL_A	4.40e-235	3	466	18	483	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
6WGD_A	7.58e-215	5	466	8	467	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.08e-170	2	466	5	477	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.40e-167	3	466	5	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
3QOM_A	7.07e-167	5	465	11	477	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	1.21e-254	4	465	6	468	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	9.67e-213	2	466	5	467	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	4.01e-201	1	465	1	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	5.89e-201	1	465	1	460	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P11988	1.78e-196	5	465	4	459	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001309_03717.