CAZyme Information: MGYG000001310_01417

Basic Information

• Species: Mediterraneibacter lactaris
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter lactaris
• CAZyme ID: MGYG000001310_01417
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1535		168313.63	4.5037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001310	2729735	Isolate	not provided	not provided

• Gene Location: Start: 2011; End: 6618 Strand: +

Full Sequence      

MIIDQTVDAFSDTMSGQIGMRVWGEPTETHGCALKFDNIKTSDIFSAVSIDPKSVKLEQD
TAAAQDIEVAITGENTLSAIKNGSEVLERGTDYTVNGQNVTIKTTYLEKIKSQSSTKLVF
EFEDGQTQTFTININIPEPTVSYTRNFAADGADGFTKKSGSGSMSLENGAMKLQGDGVFI
DDNSASLKDQEIEFTYDPMNDNCGYGAVLRYVSDNEYFYVGPSSQNNQHYTRWNIWNAQG
QSLLGSEYNDSGFILANRVVPYKIKVRIVDKYVTVFVDNEEILNRELSNVTTNPGKVGFR
TGSNNGMLIQKFTQENAAVPTVVENTEPVTIQSDAMTVRLDRAFPRVIDYTLKNGGETVK
GQELALHQIELNNKLYTPDVTADISENKAVYHVSEATTGISFDVIFTVEGNVLSMNVKNI
VDDQTKLYTLNFPRHSLISMSSKDADGKLTVNNYQGQNAISLSSANASEAYNETTLAVLS
NRNVAAALSGESYKNRHEVAYQTFAAGDHNSTGLWMNEYTYRGLDGEIMYLPAVKVAVTA
DCNGDGKVDAQDGAIVLRDKCMTRKSGADEVTDSWTMIAMNVGSEAQYPFLRILDNVKKM
YLATDGFGQNIIIKGYQGEGHDSSHPDYANYNKHAGGLEDFNTLLSEAEKYNAQIGIHVN
QTDTYPEAPQYGKLAASLPAWDWYDSSKGIIRENDDLDTSENGLDGRFSQLYDKDTQGKI
DTTYVDVFFGTRWPMYKLIQNIKGRNIILGTENPDEMVSHSVFVHGIQTGAGNFKGAGNL
VRFVENNQSDIFQGTTLFRGIQSRNNGGDTGGASKGGAGIDGWQQSSQGNNAASMNDSLD
TFYCEVLPAKFLAQYPLMQYESESRAVLGNSNEVVTEIVNNVNVITLDGEKVAEGNKIFI
PWEKDDDEQGKIYHYNKDGGSSTWTLPESWGNVTEVTIYKLSAEGKSDKKTLPVTGRKVT
IDATAKTGYVLYKEDAVKVDTADTMEWSTGSPVKDMGFDSYNFDEWKPSSTSDSVDHIKI
KDNSLGNAHLYIEGTKDGQVSQTLTGLVPGQAYSASVWCITDDGRKASIEVKNGDEVVSN
YMEQSNVTYGVHHNDKYLTKAQRMQVRFTAASDTVKLTLSAAAGKSDTSVVDFDDVRVAK
VDASTNPDPNKYTYWEDFENVDQGFGVFVSTESDQSHLSQKNPVNPEYTTDVIDGNYSLK
IRAKDYMRTIPSTVRFKPNTEYKVGIEYKAPSANAFTFAVKSDKASKTLASAVANAQSGK
LVLEFTTGDEEDCYVDITGQSSEYYVDNFYVEEAYIPADFSELQKAVDEAEKLDRTVYMT
EYYAGLDKILAEAEKVLDNPRTEQSEVDEMTQKVRDAINALQPLATNADFAALEKAVEEA
EKIIVKDYKDTSDFESALAAAKLLLEGKETKKELKHTEVATATDTLVEKQKALKPVDPKP
VDPDPVDPKPVDPNPVDPDPVAPGKPSTPDNSNGAGQTTGSGKPSADQKNPAMGTKKSGK
ATKTGDTTPVVPVAGGVLVSAMMLLANFLKKKKDN

Enzyme Prediction     

No EC number prediction in MGYG000001310_01417.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	334	872	9.4e-92	0.8062234794908062

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14244	GH_101_like	2.28e-80	564	862	1	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam12905	Glyco_hydro_101	2.11e-69	551	806	1	268	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
pfam18080	Gal_mutarotas_3	1.58e-46	331	549	1	242	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	3.50e-23	845	946	1	110	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
pfam03442	CBM_X2	4.70e-16	50	132	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK22105.1	0.0	2	1389	177	1565
BBK62189.1	0.0	2	1389	177	1565
ATD58436.1	0.0	13	1406	371	1740
ATD54117.1	0.0	13	1406	371	1740
QBJ76357.1	0.0	13	1406	371	1740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A55_A	1.63e-93	330	1240	20	1019	Thenative structure of GH101 from Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae TIGR4]
5A57_A	1.76e-93	330	1240	18	1017	Thestructure of GH101 from Streptococcus pneumoniae TIGR4 in complex with PUGT [Streptococcus pneumoniae TIGR4]
5A56_A	1.76e-93	330	1240	18	1017	Thestructure of GH101 from Streptococcus pneumoniae TIGR4 in complex with 1-O-methyl-T-antigen [Streptococcus pneumoniae TIGR4]
5A59_A	4.33e-93	330	1240	18	1017	Thestructure of GH101 E796Q mutant from Streptococcus pneumoniae TIGR4 in complex with T-antigen [Streptococcus pneumoniae TIGR4],5A5A_A The structure of GH101 E796Q mutant from Streptococcus pneumoniae TIGR4 in complex with PNP-T-antigen [Streptococcus pneumoniae TIGR4]
5A58_A	7.89e-93	330	1240	18	1017	Thestructure of GH101 D764N mutant from Streptococcus pneumoniae TIGR4 in complex with serinyl T-antigen [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2MGH6	1.20e-91	297	1240	299	1332	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	1.60e-91	297	1240	299	1332	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
A9WNA0	1.83e-87	329	1238	50	973	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
Q3MUH7	7.34e-06	50	125	783	858	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
1507	1529