CAZyme Information: MGYG000001311_03884

Basic Information

• Species: Enterocloster sp000155435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp000155435
• CAZyme ID: MGYG000001311_03884
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001311_108|CGC12	44009.15	4.9531

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001311	6514476	Isolate	not provided	not provided

• Gene Location: Start: 849686; End: 850807 Strand: -

Full Sequence      

MDKIRGVNLGNWLVLEKWMQRRLFEGFDGNDETDFCTDLPEAEKRARLKVHRDTFITYED
IRNIKAYGMNLIRIPVPHFIFGDDPAWCEPYVGCIGYLDELFEWCRELNLKILIDLHTVP
DSQNGFDNGGICGVCLWHKKPENIERALRVLEMLAGRYKDHPALYGIQLLNEPIEASMLE
ENLRKYRARDPERSAQSEAVPTGLLKDFYLEGYRRLRGYLDEDKAIVFHDGFRLKEWVGF
MQGPEFKNIVFDTHIYDAMNGPAGRDSMPYSYYAGLLEEHAAELRFMRQFFPVIVGEWSL
MHFVPEQETFSDLEQKMSYRLMADMQLQTWERNTDGWIFWSYKVIYPDNRTNPGWSLKDC
IRKDWFPSEWSGI

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	343	5.9e-103	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.12e-20	1	178	15	196	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.42e-06	51	342	20	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79423.1	4.99e-113	1	371	1	371
AUS97523.1	2.70e-109	1	366	1	334
QYO68099.1	3.70e-106	5	373	8	375
AZK47550.1	4.98e-104	4	369	3	387
AWY98291.1	8.26e-104	4	367	3	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.16e-87	3	367	2	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	9.26e-87	3	367	2	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
2PF0_A	3.13e-35	4	367	15	385	ChainA, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	3.91e-35	4	367	9	379	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.34e-35	4	367	15	385	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B5X8	8.51e-45	2	367	27	391	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
A2RAR6	5.66e-44	4	368	42	404	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q12725	1.22e-43	2	344	35	389	Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=EXG1 PE=3 SV=2
B8N151	1.27e-42	2	368	29	394	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	1.27e-42	2	368	29	394	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001311_03884.