CAZyme Information: MGYG000001312_00244

Basic Information

• Species: Helicobacter_D pullorum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D pullorum
• CAZyme ID: MGYG000001312_00244
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000001312_39|CGC2	38188.96	10.4435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001312	1919109	Isolate	not provided	not provided

• Gene Location: Start: 93657; End: 94670 Strand: +

Full Sequence      

MLKPIKVAFIRLTAMGDIIHSASILPLLHQKLSQTHNPTFHWYVDSSFKEILESSPFVDK
LIAIPLKQSIQQKSFKNLYLIYKTLKSESYDIVIDLQGLIKSAIVGKILRSKKYVGFDFK
STKESLAALFYTQKIHIPYHEHILLRNATLAFNALNLPTPNLQTLFNPKPFLSFNPALTP
QLPKNSKNILFVLETSKPNKTYPKALFLELVKLFNAIGISPILLTHKTTINDSSLHFYHF
TNLSLNAIKALLAQMDLIIGGDTGITHLAWALQKPSITLFGATPPKRFHLQTLINLYLVA
TPDNTNKKSYDKKNFSIQTIPPQEIFNLAKSLLERKI

Enzyme Prediction     

No EC number prediction in MGYG000001312_00244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	82	289	2.9e-30	0.8311111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02193	heptsyl_trn_I	3.84e-83	6	333	1	319	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0859	RfaF	6.26e-55	4	336	1	333	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	4.77e-47	83	303	6	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	1.95e-35	6	334	2	321	lipopolysaccharide heptosyltransferase RfaC.
cd03789	GT9_LPS_heptosyltransferase	5.47e-34	6	330	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ07021.1	2.00e-239	1	337	1	337
QOQ98443.1	3.51e-114	3	337	3	330
BAW39031.1	2.33e-82	6	336	2	335
BAW55901.1	6.60e-82	6	336	2	335
BAM96196.1	6.60e-82	6	336	2	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	4.36e-24	6	285	2	284	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	4.36e-24	6	285	2	284	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	4.92e-24	6	285	2	284	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	5.91e-24	6	285	2	284	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	5.45e-23	6	285	2	284	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
Q57336	6.24e-11	4	297	8	302	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001312_00244.