CAZyme Information: MGYG000001312_00387

Basic Information

• Species: Helicobacter_D pullorum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D pullorum
• CAZyme ID: MGYG000001312_00387
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000001312_40|CGC1	46592.76	8.5023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001312	1919109	Isolate	not provided	not provided

• Gene Location: Start: 75784; End: 76992 Strand: +

Full Sequence      

MMIFCFLIACAYAYFFGLFNPLIAQIKAYLFGEIQYSSAYIYASVVDSILETSSHGFETL
VQRSGGWLLFALGLIGFLCFGFYFVSKRHNFIYLCIFLFPFLLLGFASLELGVRFSLFLA
PILAFGVVLFFAGILDIMRRFLKTSMVVFAGYVALFLATLEYSIPKPILTNQEIRSLQSF
CFLKDDIVFSWWDYGYALEYFTKAEVLLDGGLHSGSINYPIAEILMNKSPILARNFSLIL
AQKMQNTPKNQWKLLFEQIIQENKSNPNIFLDSLQKKDYNIGNLPKGEVYWVLPKRIMPL
VANIHSFRNINLQNGKRLRESVFVYGDMPLKSAEEYFVFSDFYIKRSQDGIPLVKVFWEG
REIVMDFEYLKSNLVQWLIFRNNPAMNLVFENDFVVVYQVRK

Enzyme Prediction     

No EC number prediction in MGYG000001312_00387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	3	281	7.3e-31	0.4069264069264069

CDD Domains     

MGYG000001312_00387 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ08217.1	9.50e-281	1	402	292	693
ADM36001.1	7.35e-278	1	402	292	693
QOQ98180.1	8.23e-84	8	401	335	730
CAE09214.1	7.65e-28	17	325	282	592
VEG81426.1	7.65e-28	17	325	282	592

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RCE_A	7.12e-15	17	323	281	595	Bacterialoligosaccharyltransferase PglB [Campylobacter lari]
5OGL_A	2.96e-14	17	323	281	595	Structureof bacterial oligosaccharyltransferase PglB in complex with an acceptor peptide and an lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
6GXC_A	2.98e-14	17	323	281	595	Bacterialoligosaccharyltransferase PglB in complex with an inhibitory peptide and a reactive lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
3AAG_A	2.89e-11	184	315	28	164	Crystalstructure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221],3AAG_B Crystal structure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HTX9	1.32e-22	20	315	282	586	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=pglB PE=1 SV=1
Q0P9C8	1.78e-22	20	315	282	586	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglB PE=1 SV=1
B9KDD4	2.90e-15	17	323	281	595	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) OX=306263 GN=pglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.990204	0.009710	0.000026	0.000015	0.000014	0.000025

TMHMM  Annotations     

start	end
2	24
64	86
91	113
117	134
141	160