CAZyme Information: MGYG000001312_01259

Basic Information

• Species: Helicobacter_D pullorum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D pullorum
• CAZyme ID: MGYG000001312_01259
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725	MGYG000001312_43|CGC3	86552.5	9.1655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001312	1919109	Isolate	not provided	not provided

• Gene Location: Start: 200813; End: 202990 Strand: -

Full Sequence      

MPLLSVIIPFGLSREREYIEKRVINKAFEFCSDGEIEYIFVEGFSSYKSNIEQIIKERGH
IYIKDDGQRFFSQGRCRNLGASYANAPVLFFLDVDYYLSRFSFEKVMDIIKYRNIANNIN
QILCLPVVFLNKEGSDYLLSKDQTKWDMIVQDDLITGKSQWIKFFAPNSTSSIVINKHKF
LEIGGNDERFVGHGYEDFDLLARILHSCVKFEKMPKNLLYDSRNWNFKDYKGFRAWFSIL
GYEMSFYGIYLYHLWHIEPNQNFYMSNKEANHKLFYNHLKNLKKHSIKPLQIARAKDKKV
LLICRFPKDILNVLRDVSVYLGDILHIQEDEFFRDDLFNCDQFLSFLQERKIDIVLFPNP
YGNELRVKIYKFVRANNISYLCFDRGALPDSWFFDCNGFNADSLSYQLWDKELREDEIVK
TKEYISKTLEEDNYLEKQDKRRSHLKKRLFLSDKKKIIFVPLQKSDDTVIKYFSNYFTYE
KFLETIDELAKELSKTHIFVIKRHPLGDKILCSKYKNLIFVPDNTNIIDCLEMCHVVVCL
NSGVGVYAMMLKKPCIICAEAFYYIEGVNFKVTSKQELLEALISEFVIDETKMIKFIHYL
VYEFYSFGSVTYRRYSKKGKIYNKAINIDFYELQLQGKKVLSIKPYTKVYYRLKSLMYQA
YAYELDNRNIFAWMMKVLMPDWLQMRISHTKFYRLFRKLLFDPRQFLNDSRKLHFINNIL
YGKIR

Enzyme Prediction     

No EC number prediction in MGYG000001312_01259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	281	8.2e-97	0.9963768115942029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10111	Glyco_tranf_2_2	5.25e-92	5	281	1	276	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG4092	COG4092	1.50e-88	1	320	1	328	Predicted glycosyltransferase involved in capsule biosynthesis [Cell wall/membrane/envelope biogenesis].
cd16438	beta_Kdo_transferase_KpsS_like	2.85e-23	374	604	19	247	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS like. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
cd16441	beta_Kdo_transferase_KpsS	8.36e-08	440	578	128	274	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
pfam05159	Capsule_synth	4.18e-07	353	568	2	271	Capsule polysaccharide biosynthesis protein. This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS and LipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAX99154.1	5.82e-266	1	711	1	714
ASN50675.1	2.35e-265	1	711	1	714
ASQ34355.1	2.35e-265	1	711	1	714
CAI38887.1	2.61e-265	1	711	4	717
EAQ72655.2	2.61e-265	1	711	4	717

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001312_01259.