CAZyme Information: MGYG000001313_00393

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_00393
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000001313_17|CGC4	41996.1	7.9732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 416047; End: 417153 Strand: -

Full Sequence      

MYMKKILFLLLAVICCGLHAQQPFSSGMNKEDIAKVCNAVAEWQINHQSGVKHHPLDWTN
GALYRGMTEWGKVSGNKFCYDFVYAIGEKYNWNMWDNVYHADDICVGQAFIEMYRKLNDK
RMLQPVLERAYYVASHPSKAPLQKTDAIGTSERWSWSDALFMAPPVYAALYTITGDRIYL
DYLDTEYKACVDSLYDKEEHLFYRDNKRIPLREKNGSKQFWGRGNGWVFGGLPLIIDNLP
FDCPSRNYYVRLFVEMAEAVRATQCKDGDWRTSLLDPDSYNMPENSCSAFMCYGIAWGIR
NGYLFKRTYKPVLEKGWKSLVKAVHADGKLGYIQPVGAAPRAAGFDATDVYGVGAFLLAG
SELYKSVK

Enzyme Prediction     

No EC number prediction in MGYG000001313_00393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	54	365	2.4e-83	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.10e-85	40	365	5	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.28e-50	57	365	35	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49255.1	1.70e-287	3	368	1	366
QUT45004.1	3.30e-285	3	368	1	366
QDH57430.1	1.36e-246	3	365	1	363
QDO70976.1	1.62e-237	3	368	1	365
QRQ48187.1	3.55e-225	3	367	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.05e-72	42	365	38	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	9.96e-54	3	362	1	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.30e-45	154	362	139	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	9.93e-75	27	365	28	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	6.02e-73	35	363	59	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	9.70e-72	4	365	3	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000224	0.999170	0.000191	0.000145	0.000133	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001313_00393.