CAZyme Information: MGYG000001313_00531

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_00531
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290	MGYG000001313_17|CGC6	34319.22	8.552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 610695; End: 611567 Strand: -

Full Sequence      

MECFKTFRKAPPSQLIMTLLVKNEESMLEENLLFHKAMGVDSFIITDNNSTDSTPEIIRK
YKQKGWIKEVIEEKATDYEQKEWVDRMIWKAKTIYKADWIINADADELWYSPSGNLKTDL
SATHANVLNCEMRSVYPEENRPFWQWDKVVKPVSEPERYDLSTYSIFERQNKKVIHRSAG
YLQISMGNHKVTMLPQLSTDSGIRIYHYNIRGKQQFLEKMINGGRQLEQHKGRHGGRHWR
YFYKLYKEGKLEAEYDRVIGTSFYKALCEKQFIIPDTTIPDVFKELNIHQ

Enzyme Prediction     

No EC number prediction in MGYG000001313_00531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	22	116	9.2e-16	0.9479166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13704	Glyco_tranf_2_4	7.70e-13	22	113	1	89	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,
cd02511	Beta4Glucosyltransferase	2.46e-07	19	107	6	82	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	2.10e-05	21	112	6	93	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam01697	Glyco_transf_92	8.17e-05	26	234	18	238	Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily.
cd04196	GT_2_like_d	4.18e-04	41	111	28	94	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49132.1	2.23e-218	2	290	16	304
QUT44871.1	5.28e-202	1	287	1	287
QUT86533.1	5.17e-173	7	287	20	300
ALK83397.1	2.26e-172	7	287	20	300
ABR38758.1	2.26e-172	7	287	20	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001313_00531.