CAZyme Information: MGYG000001313_00739

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_00739
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
882	MGYG000001313_17|CGC11	100477.56	7.506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 868545; End: 871193 Strand: +

Full Sequence      

MKILCKSALLFLLVAVIPLTGMATATNIDRIRCEYLKNPLGIDVATPRFTWEISAGHNGK
QTACRLKVATSPQLLKRGKADVWKSRRVNTDIPRMVYQGPALQAHTRYYWQVEVWSNSRK
LTSEIASFETAKLSITDWHDAKWISDTFDKEFRKAPLLRKSISLEEKNIKNARLYVSGVG
YYEFFINGAHVSDRKLEPGYTHFDKRVLYSTYDVTSMLQHGENVLAAELGNGWLNIQSLS
VWEFEKARWRMRPRMIAELRITYNDGTVQTIPTDRTWKTNSGACSFNNLYSGEVYDARLV
HKGWTIPGFDDKKWMPAIEVEAPAKILTSQQMPPIRVVREVKPVSMRKIDDYTYIYDMGE
NMTGVCRLQVQGPTGTCVTLAHGELIHDDGTLNQGNIEIYFKREKNGLPQHVDPFERIQT
DTYFLSGNGMETYEPRFTYHGFRYVEVASTRPLTLTQESLTGLCMHTDVEPVGNFACSNE
ILNKLVEASCNSYLGNLFSIPTDCPQREKNGWTADGYVGMDYGLLFYDGITVYEKWMNDF
IDNQRERGDLSGIIPSSGWGYADWIGPVWDAALFIIPNNLYKYYGDTRAIEKMWDTCVRY
LQYLEAREKDGKLTYGIGDWVFYKAKTDTHFTSTAFYWLDNVLMAKFADLTGHDGTKYRA
KADNLKELINNEWFDAEKKMYANGTQAAQSVGLALGLVPEEHAQAVADNLVRMIRDNGHQ
LDFGMLGSKFVPAMLVKYGYADDAYKMIIRPEAPSWANWIHRGLTTLPETWVLDKDFKDA
SLNHAFLGDISAWMMNSLAGINPNPKKPGFAGIIIRPQFINGISWAKGEYRSVRGLIRSE
WKREGNQIELNIIIPANTEAELQLRDKSVALKTGKNQLTINL

Enzyme Prediction     

No EC number prediction in MGYG000001313_00739.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	347	864	1.3e-151	0.996031746031746
CBM67	141	323	1e-39	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.08e-96	472	798	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.74e-71	167	339	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.69e-32	347	466	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.95e-18	800	864	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48940.1	0.0	1	882	1	882
AST53792.1	0.0	31	879	32	857
QUT95157.1	0.0	31	879	32	857
QIX67103.1	0.0	31	874	30	850
QUT19200.1	0.0	31	879	30	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.30e-155	31	864	35	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	8.10e-111	158	862	305	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.36e-97	25	867	1	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.34e-127	22	864	26	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.40e-111	34	861	38	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	3.48e-110	158	862	305	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.24e-105	34	879	42	894	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999149	0.000162	0.000158	0.000144	0.000131

TMHMM  Annotations     

start	end
7	26