CAZyme Information: MGYG000001313_02465

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_02465
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000001313_19|CGC9	41731.45	6.5876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 776353; End: 777462 Strand: +

Full Sequence      

MKNRKTLLAVLAGLALSSCTTRVTTENDASLKGVLGDKFLVGVALNTRQSSGVDTAAVKI
VKRHFNSVVAENCMKCQTIHPEEDRYDFSQADEFVKFGEDNGMYIIGHCLVWHSQLAPWF
CVDKDGNNVAPEVLKQRLKDHITTIVSRYKGRVKGWDVVNEAILEDGSYRKSKFYEILGE
EFIPLAFQYAHEADPEAELYYNDYNMHEAGKRATVVKLVNDMKSKGLRVDAIGMQGHVGL
DYPSLTDFEESMLAYASTGAKVMITEWDMSALPTLKRTANVSDTVAYKKMLNPYPESLPD
SVSQQWNNRMSDFLNLFIKHSDFVSRVTAWGVSDGDSWKNGFPVRGRKDYALLFDRDYQP
KDFIKKILE

Enzyme Prediction     

No EC number prediction in MGYG000001313_02465.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	31	368	9.8e-103	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	3.62e-114	31	361	1	302	Glycosyl hydrolase family 10.
smart00633	Glyco_10	2.12e-107	74	361	1	257	Glycosyl hydrolase family 10.
COG3693	XynA	1.36e-88	43	369	36	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48270.1	1.14e-277	1	369	1	369
QUT46123.1	1.14e-277	1	369	1	369
QUT92911.1	7.36e-215	1	369	1	369
ALJ61519.1	1.22e-213	1	369	1	369
AVM52700.1	2.90e-208	1	369	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UQY_A	3.11e-100	12	369	5	367	XylanaseXyn10B mutant (E262S) from Cellvibrio mixtus in complex with xylopentaose [Cellvibrio mixtus],1UQZ_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with 4-O-methyl glucuronic acid [Cellvibrio mixtus],1UR1_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha-1,3 linked to xylobiose [Cellvibrio mixtus],1UR2_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha 1,3 linked to xylotriose [Cellvibrio mixtus]
2CNC_A	3.21e-99	3	369	4	376	Family10 xylanase [Cellvibrio mixtus]
4PMU_A	9.13e-97	30	368	2	350	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_C Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_D Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_E Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_F Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306]
4PMV_A	9.43e-97	30	368	3	351	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306],4PMV_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306]
6FHE_A	1.01e-91	26	361	7	332	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49942	1.18e-178	1	369	1	370	Endo-1,4-beta-xylanase A OS=Bacteroides ovatus OX=28116 GN=xylI PE=2 SV=1
P48789	1.18e-123	14	369	9	366	Endo-1,4-beta-xylanase A OS=Prevotella ruminicola OX=839 GN=xynA PE=3 SV=1
O69231	5.45e-75	30	368	7	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
Q12603	6.90e-72	7	369	11	351	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P45703	2.53e-69	30	361	7	321	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000042	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001313_02465.