CAZyme Information: MGYG000001313_02556

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_02556
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000001313_19|CGC11	41253.27	7.9718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 892016; End: 893113 Strand: +

Full Sequence      

MKKQLIFSMLFIGSSLCAANPFSGSMKKGDVEKVCNAVAKWQIVNHEQVKHNQLDWTNGT
LYRGMTEWGKTSGNQDCYNFVNEIGEKHNWNVWDRVYHADDICVGQAFIEMYRKMGDRRM
LQPTLERAFYVASHPSKAPLLKIDAIGKDERWSWSDALFMAPPVYAALYQITGEKIYLDY
MDSEYKACVDSLYDKEEHLFYRDCKRIPLREKNGKKQFWGRGNGWVFGGLPLIIDNLPIG
CASRNYYISLFVEMAESVKATQCKGGDWRTSLLDPDSYDMPENSCSAFMCYGIAWGIRNG
YLPKKTYGKVLEKGWRSLVSAVHADGKLGYIQPVGAAPKAAGYDATDVYGVGAFLLVGSE
IIKGL

Enzyme Prediction     

No EC number prediction in MGYG000001313_02556.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	362	1e-82	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.87e-88	38	363	5	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.31e-48	55	360	35	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48187.1	4.16e-287	1	365	1	365
QRQ49255.1	3.42e-227	1	365	1	365
QUT45004.1	4.85e-227	1	365	1	365
QDH57430.1	2.21e-226	1	363	1	363
QDO70976.1	2.87e-221	1	363	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.93e-71	40	363	38	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.11e-55	1	365	1	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.21e-47	56	365	39	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	2.49e-74	1	362	6	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	2.54e-74	1	363	1	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.95e-70	40	363	45	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001848	0.926341	0.070978	0.000338	0.000241	0.000232

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001313_02556.