CAZyme Information: MGYG000001313_02665

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_02665
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		88776.84	6.8984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 1010502; End: 1012847 Strand: -

Full Sequence      

MKSPLTCLLLFCFLLAGKAQTRQAVSYFPLQDIKLLESPFLQAQQTDLYYIMAMNPDRLL
APFLREAGLAPKAPSYTNWENTGLDGHIGGHYISALSMMYAATGDTTVYNRLNYMLNELH
RAQQAVGNGFIGGTPGSLQLWKEIKEGSIRPESFSLNGKWVPLYNIHKTYAGLRDAYLYA
GSDLARQMLIALTDWMAGITSGLTEQQMQDMLRSEHGGLNEIFADVADITGDKKYLELAR
RFSHKTLLEPLIGGEDHLTGMHANTQIPKVIGYKRIADLTQNDAWDQAARFFWNTVVNHR
SVCIGGNSVREHFHPADNFTSMLNDVQGPETCNTYNMLRLTKMLFQTSPDIRFADYYERA
LYNHILASQQPAKGGFVYFTPMRSGHYRVYSQPETSMWCCVGSGLENHTKYGEFIYAHAE
DTLYVNLFIPSRLTWKEQKLTLVQESRFPDEAQIRFRIEKSNKKTFSLKFRYPSWAKGAS
VSVNGKVQDINAQPGEYLTVRRKWKAGDEITLNLPMQVTLEQIPDQEHFYAFMYGPIVLA
SPTGTENMDGLYADDSRGGHIAHGKLVSLEKMPMLIGSSASLPQALRKTDDEQLSFSYTG
SVYPTQKEALRLIPFFRLHDSRYAIYFHQVSEAEVESIRQEMERKERKAMELANQTADII
FPGEQQPESDHGIRYEQAETGTDRDRHFRRAKGWFGYTLKTSKEASRLMITTRKNDPMKV
AILLNNERLTADPTISEADQEGFVTLCYPLPQKLGAGNYPIRFSPDGTEWTPAIYEIRLL
E

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	540	3.9e-219	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	32	540	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.39e-133	30	616	9	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.62e-38	544	627	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48086.1	0.0	1	781	1	781
QUT46350.1	0.0	1	781	1	781
QUT90786.1	0.0	5	781	6	782
ALJ58196.1	0.0	5	781	6	782
QDO70922.1	0.0	1	781	1	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OPJ_A	0.0	17	781	17	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6YQH_AAA	0.0	1	781	1	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
6EX6_A	6.82e-24	230	616	206	609	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.86e-21	92	538	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.29e-20	282	538	285	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.998942	0.000281	0.000168	0.000150	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001313_02665.