CAZyme Information: MGYG000001313_02996

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_02996
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	MGYG000001313_20|CGC1	57109.18	5.9721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 53438; End: 54973 Strand: +

Full Sequence      

MKGLKVLLFGMCMALCACSSQTSTVQTSDKGTRWQWENGTIVVETPERPAGQKSVIGLAL
PKMEAVRVGFVGLGMRGPGAVERFTHIPGTQVVALCDYEQERAEQCQKYLEQASMPKAAV
YSGEKGYEELCKRDDIDLVYIATDWLHHFPVAMCAMENGKNVAIEVPSAMNLKECWDLIN
MSEKTRKHCMILENCCYDWFEMNTLNMAQHGVFGEVIRAQGAYIHNLSPFWNHYWKNGES
DKLGWRLDYNMRHRGDVYATHGLGPVAQALDIHRGDRMQTLVAMDTKSVVGKSLVEARTD
SACGNFRNGDHTTTLIRTANGKVIEIQHNVMTPQPYNRLYQLTGSKGFANKYPVEGYALD
ADQLTASGVEPKVDDLNSHGFLPEVEMEALVAKYQHPILKKYGDMAKEVGGHGGMDFIMD
SRLVYCLQNGLPLDMDVYDLAEWCCLAELGELSMDNNCAPVAFPDFTRGEWNVVKGYKHA
YASSEDEAAAMEKAKTFTAKLKEQGAKEWVK

Enzyme Prediction     

No EC number prediction in MGYG000001313_02996.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	62	472	8e-160	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.51e-21	63	391	1	302	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	5.83e-14	66	191	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	2.30e-04	64	216	3	145	putative oxidoreductase; Provisional
COG4091	COG4091	0.004	66	177	18	149	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49631.1	0.0	1	511	1	511
QUT44459.1	0.0	1	511	1	511
QUT62233.1	0.0	1	509	1	509
QQA30686.1	0.0	1	509	1	509
QUU00485.1	0.0	1	509	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	5.38e-81	48	471	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	4.16e-66	66	486	21	443	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E9M_A	2.50e-06	102	220	39	152	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3E18_A	6.45e-06	58	245	1	177	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	0.0	1	509	1	510	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	0.0	1	511	1	513	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	2.44e-240	4	506	3	502	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	1.30e-210	4	482	1	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
P0C863	1.56e-208	2	482	3	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001313_02996.