CAZyme Information: MGYG000001314_01930

Basic Information

• Species: Bacteroides_F pectinophilus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Bacteroides_F; Bacteroides_F pectinophilus
• CAZyme ID: MGYG000001314_01930
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000001314_8|CGC12	42817.58	5.1161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001314	3025526	Isolate	not provided	not provided

• Gene Location: Start: 1408272; End: 1409366 Strand: +

Full Sequence      

MKNQKVEKFIDGYLKNFKSAKVDKWNYEDGCVLKGAQMMYQVTGEEKYKTFILEYLKKYI
NEDGTINYYNAEDYNIDNVSTGTVLFFAYDETGEEKYRNAIEHIMDQLRKQPRTQEGNFW
HKNIYPNQVWLDGLYMGQVFYMMYESRFGGKEHYSDIIKQFKLVRRNMFNDEKQLYYHAY
DESRQMYWADKTTGLSQNFWLRSMGWYLLALIECLDAIDQSVYEYYDDLKSLFKEALKGV
LKYQDEKTHLFYQVIDRADVKENYLETSGSAMIAYAMLKACRMKAVLAEKYEDNAISIFE
ALADNKLEEVDGELKLGGICSVAGLGGKEKRDGSLKYYFSEPVVYDDHKGVGPFIMAYSE
INRL

Enzyme Prediction     

No EC number prediction in MGYG000001314_01930.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	18	362	1.2e-109	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.43e-89	1	364	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.75e-78	21	364	23	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
pfam03663	Glyco_hydro_76	8.39e-04	24	80	216	279	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ62178.1	9.10e-165	3	364	5	365
BCJ96410.1	9.77e-147	1	360	1	360
BCJ93648.1	3.50e-142	1	364	1	364
AFK85204.1	4.90e-136	5	364	3	360
ADD02984.1	7.13e-136	6	361	8	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.18e-102	23	364	21	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.30e-62	23	364	37	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.24e-61	23	364	27	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.25e-08	25	286	65	313	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.26e-07	25	286	66	314	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.90e-61	23	364	37	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.97e-35	136	360	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.97e-35	136	360	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001314_01930.