CAZyme Information: MGYG000001315_00764

Basic Information

• Species: Bariatricus comes
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Bariatricus; Bariatricus comes
• CAZyme ID: MGYG000001315_00764
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
94		10606.1	10.0968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001315	3238915	Isolate	not provided	not provided

• Gene Location: Start: 702241; End: 702525 Strand: +

Full Sequence      

MIDYISGASTETLAKEVRAGKYGNGEVRKTVLGKRYEEVQSRVNAEENKYHIVKSGDTLS
KIAAIYGTSYQEIARLNKLQNPNLIYVGQRLRIK

Enzyme Prediction     

No EC number prediction in MGYG000001315_00764.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	51	93	3.1e-17	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	8.11e-18	49	93	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.08e-16	51	94	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	4.19e-16	50	93	1	44	Lysin motif.
PRK11198	PRK11198	3.59e-12	45	93	92	145	LysM domain/BON superfamily protein; Provisional
COG1388	LysM	4.76e-08	29	94	47	111	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50341.1	5.85e-38	1	94	253	346
QRT50187.1	1.56e-15	28	94	326	396
CBK80688.1	1.89e-15	9	94	232	362
AVJ51161.1	7.42e-15	9	93	228	319
AVJ51719.1	7.42e-15	9	93	228	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MKX_A	6.80e-08	48	94	4	49	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49UX4	8.50e-08	51	93	88	129	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q37896	1.94e-07	8	93	113	208	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
Q6GJK9	2.19e-07	44	93	153	201	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
Q6GHI8	2.24e-07	45	93	171	219	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=lytN PE=3 SV=2
Q7A123	2.24e-07	45	93	171	219	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MW2) OX=196620 GN=lytN PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000033	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001315_00764.