CAZyme Information: MGYG000001316_00231

Basic Information

• Species: Mitsuokella multacida
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Mitsuokella; Mitsuokella multacida
• CAZyme ID: MGYG000001316_00231
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
826		96037.15	6.3955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001316	2574556	Isolate	not provided	not provided

• Gene Location: Start: 178968; End: 181448 Strand: +

Full Sequence      

MEKDHLKAGQIMSVQIVEDCSAAQHSHGDIELLYILSGYVQVTVGSENQSLKERDILVIN
ANREHSYIGSEGMLMARFLISLQGIKEMMGQSIVLLRCCSAREQHEAFSSLRFLIGRILN
DILTHNNSQIYRNSLYYQMLHILTSNFLIPPEEIHYRTDVDKDELRLQEIFAYIRTNYRH
NIRLKDLAQHLFLSETYVSKYISQKCGINFVGLVNHIRLEYAMDDLIESDVSIIHLAMDN
GFVSVAAFNHYFQQAYQMNPSAFRKRYRQQRREQQERVKNIQKEQEVKQRIDAFLREEAD
GGTAYDRREITVQVDTAIDGMHFEKANLVAVINVGTAVELLDAGLRAQLLASQRRLGFRY
VRFWNLYGEGMNFDIHAKGPLNFNRLDNILDFLLEHQLRPYIELGCKPYRILRTTKTAVR
DDYAPNGDFRDLQEEREFYRQLAVHLEQRYGDKEVANWFFELRMKEHSVFQGSQFSYTPL
SAADHQQFFREFDAVAAVLQQSLPSLRLGGGGFPVQHYGREELQACVERWLKNHVRPAFI
SMTGFPYHLEQHEGDMYFEKRITDEEFIRHNVQLMERVLASVGLAGVPIHLSEYAMSLSS
RNAMNDSCYRGAFLMRTLISCVSCQNLLMGQWLFSDLHSEYKDTRGLLFGGSGLVTRDGI
PKPAWFAFDFFHACHDRFLAMEEHCLVTGGEDIGYRLVCHNGKHLNYHYYMTPEDQVDGR
AISTYLEDRDVLCLHIVLRHLKNGRYIIRQRRIDDGDGSIQDEWNELDCMEGLTSLEVRH
LAKITMAHLSIRHRQVEDGTLQLDLELRPDEIRYLEISKSLDWLES

Enzyme Prediction     

No EC number prediction in MGYG000001316_00231.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	331	767	3e-52	0.9559164733178654

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	2.59e-32	341	808	31	478	Glycosyl hydrolases family 39.
COG3664	XynB	1.08e-23	340	817	1	424	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	1.35e-19	166	267	21	122	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	4.68e-18	181	264	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	8.41e-16	187	266	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58080.1	2.25e-144	3	818	2	799
AQR96769.1	1.74e-143	3	818	2	799
BBG22497.1	1.51e-123	3	819	2	807
AQR96727.1	2.49e-107	11	817	6	790
QSF46208.1	1.60e-106	12	824	17	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EKJ_A	8.72e-32	346	817	44	496	ChainA, Beta-xylosidase [Caulobacter vibrioides]
4M29_A	8.72e-32	346	817	44	496	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
2BS9_A	9.46e-31	353	822	43	485	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	1.70e-30	353	822	43	485	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
1W91_A	2.28e-30	353	822	43	485	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	1.85e-26	353	822	43	486	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P23552	1.61e-25	346	812	42	480	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
O30360	7.71e-25	353	822	43	484	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	5.83e-24	353	822	43	484	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q936F1	3.91e-19	111	819	104	741	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001316_00231.