CAZyme Information: MGYG000001316_00578

Basic Information

• Species: Mitsuokella multacida
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Mitsuokella; Mitsuokella multacida
• CAZyme ID: MGYG000001316_00578
• CAZy Family: CBM34
• CAZyme Description: Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1151		132654.89	5.4072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001316	2574556	Isolate	not provided	not provided

• Gene Location: Start: 318960; End: 322415 Strand: +

Full Sequence      

MLTQDQVWHDSQDINYRSPVGAAEAGSKVRMSLRLRTKEGIRQVILRCWQDQTGEYLIPL
ETKDDPFQEEHLYSGWLPLPEKGGLVWYYFIISMEDGTWYYGNNPEQLGGMGTLYDHVPP
SFQITVFNKGAKTPDWFKHAVMYQIFPDRFSREGNTIIEKKGAVFHACWQDDPCYYKDPD
TKEIVAYDFFGGNLKGIEKKLDYLKDLGISVIYLNPVFESESNHHYDTGDYHKIDPILGS
NEDFRHLVDTAKAKGIRIILDGVFSHTGSNSRYFNREGQYNTIGAFQSPDSPYYEWYNFR
NFPYEYESWWNFSTLPDVKETTPSYMDFIIYDKDSVMHHWMKEGIAGWRLDVIDELPAAF
SQAFFAELKKTDPDAVMIGEVWEDASHKVAYGVPREYLCGQEMDSAMNYPFRQILFDFLL
GRTDARMSLRRFESLRENYPRENFYAMMNLIGSHDVERAITVLGEEPFYDGMPAIEQSRA
RLSDDQYNLGMARLFMAALWQMTYPGVPCVYYGDEIAMQGFKDPYNRRPYDWEHGDTYVR
SRYERMIRVRNEHTALQTGELLPLYAEGDVMAFARLVRGGRDVFGEPAKDECFISLFNRS
LKEKKTVTLQVGDFADGVFADAFHPETRFTVENGQLTVTLLPLKGFLLQNIPPEHRYKHE
AGVLLHPTSLPSKYGVGDFGKEAYRFVDFLEKAGQHVWQILPLGPVGFSYSPYQSPSAFA
GNPLLIDIDELVEKGWLSKQEAKVTYADFDSSADFEPARTFKNKCLRKAHAAFQRDAEAQ
ADYEAFCRKEAYWLDDYALFEAAKRDYDNKGWMDWPENIKKREPAALASLAKRLAEDIAL
QKFMQYLFHRQWQRLHDYAKEKGIRIMGDMPIFLAQDSADVWANQQLFDLNPDGTAHTVA
GVPPDYFSATGQLWGNPQYNWQAMKAENYAWWKKRFQKLYEMVDIVRIDHFRGFESYWEV
DGKAKNAIKGRWLPGPGKPFFDEVRRTLGDLPIVAEDLGIITPEVEKLRDDCGFPGMKVL
EFTLYLNHQHRLSTVVPENSIVYTGTHDNNTLVGWLKDEVTPSLRKAIADLVRADVRKPE
EIASHLVGFAYASNARLAVVPMQDLLQLDGSARMNTPGTSEGNWRWCMRPGDLEKVDAAK
LHELAVRTGRA

Enzyme Prediction     

No EC number prediction in MGYG000001316_00578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	665	1139	3.5e-172	0.9676113360323887
GH13	192	524	5.9e-136	0.9936708860759493
CBM34	7	130	6.7e-16	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14510	PRK14510	0.0	9	1150	5	1220	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.
cd11338	AmyAc_CMD	0.0	139	561	1	389	Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins. Cyclomaltodextrinase (CDase; EC3.2.1.54), neopullulanase (NPase; EC 3.2.1.135), and maltogenic amylase (MA; EC 3.2.1.133) catalyze the hydrolysis of alpha-(1,4) glycosidic linkages on a number of substrates including cyclomaltodextrins (CDs), pullulan, and starch. These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Since these proteins are nearly indistinguishable from each other, they are referred to as cyclomaltodextrinases (CMDs). The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
pfam02446	Glyco_hydro_77	0.0	665	1126	1	455	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PRK14508	PRK14508	0.0	658	1151	4	497	4-alpha-glucanotransferase; Provisional
PLN02635	PLN02635	1.93e-178	649	1150	18	525	disproportionating enzyme

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL82150.1	0.0	1	1150	1	1156
ANR69627.1	0.0	1	1150	1	1149
AKT53142.1	0.0	1	1150	1	1149
AOH47405.1	0.0	1	1150	1	1149
QNH53465.1	0.0	1	1150	1	1149

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OWC_A	6.71e-144	662	1150	11	501	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]
1CWY_A	1.73e-143	662	1150	8	499	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]
1FP8_A	2.43e-143	662	1150	8	499	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
2X1I_A	1.32e-142	662	1150	8	499	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
5JIW_A	1.41e-141	662	1150	8	499	Crystalstructure of Thermus aquaticus amylomaltase (GH77) in complex with a 34-meric cycloamylose [Thermus aquaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P72785	2.35e-146	658	1150	4	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1
O87172	9.49e-143	662	1150	8	499	4-alpha-glucanotransferase OS=Thermus thermophilus OX=274 GN=malQ PE=1 SV=1
P0A3Q0	9.38e-135	658	1133	3	478	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	9.38e-135	658	1133	3	478	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
O66937	4.02e-126	661	1140	4	475	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001316_00578.