CAZyme Information: MGYG000001316_02283

Basic Information

• Species: Mitsuokella multacida
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Mitsuokella; Mitsuokella multacida
• CAZyme ID: MGYG000001316_02283
• CAZy Family: GT30
• CAZyme Description: Tetraacyldisaccharide 4'-kinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828	MGYG000001316_6|CGC15	93192.77	7.4394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001316	2574556	Isolate	not provided	not provided

• Gene Location: Start: 1358665; End: 1361151 Strand: +

Full Sequence      

MQLLYNIAGIIIVVLIIPMFMVRSVREKGFVERIRQSLGFFPEHALDKVEKKDCIWVHAA
SVGEIVATSPLIKEFRREFPKSPILVSVVTTSGYEMANRIIKDADAIIYFPLDLPWLAGH
VLRRIRPRVFLPVETELWPNFLRTARKIHVPVMMVNGRISDKSVKQYKHLHSLLRDMIGT
VKLFAMQSPIDAEYIMRLGAPKELVTVTGNTKFDQTYTDVSPEEKQRIIEEMGLTENDGI
FLAGSTHRGEEEPVLQAFKAVRKTHPHARLVIAPRELLRTTEVVHLCRKAGFTVTTRTKL
QHETPQGEDIVILDTIGELGKVYSIGDVVFVGGSLVPHGGHNILEPAAHGKAIIVGSHMF
NFKDTYALFKNRDACLTVKNGEELATEVTRLFDEPEHRHRMEEETRAIVRENKGASRKSA
VLLHQMLDAYESSPENRHHVRSTQKITNFQTYFIDLVHSKEVDGFFPNIIMGILYVFSLI
YGMLVNIKLAGYRCGIFKKAKLDCFVISLGNVTVGGTGKTPTAQRLARDIRDMGYRVVIL
NRGYRAKWHGEVGIVSDGKRLHMDAAEAGDEAYMLAKHLPEVPVLIGAERAKTGCYAMEH
FGAEVAILDDGYQHWQLERDLDILLVDAVNVFGNGYILPRGTLREPISHISRADICLMTK
VDQAAAGSCDYIRETVHRYNPDARIVESIHQPRCFIPLTEWYVNIASQGIDIAKMRGKRI
MAVSAIGNPASFEQTISDIGAVIIESLRYPDHHDYAMSEMTDIFQQAENAGAEAIVITEK
DAVKIPADVAREKWSIPIYVICVEVNFQKGSEGLSEMLQKRLAERFGH

Enzyme Prediction     

No EC number prediction in MGYG000001316_02283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	33	215	8.8e-58	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	3.08e-139	1	415	2	409	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	5.04e-126	1	415	1	407	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam02606	LpxK	9.73e-94	473	823	4	318	Tetraacyldisaccharide-1-P 4'-kinase. This family consists of tetraacyldisaccharide-1-P 4'-kinase also known as Lipid-A 4'-kinase or Lipid A biosynthesis protein LpxK, EC:2.7.1.130. This enzyme catalyzes the reaction: ATP + 2,3-bis(3-hydroxytetradecanoyl)-D -glucosaminyl-(beta-D-1,6)-2,3-bis(3-hydroxytetradecanoyl)-D-glu cosam inyl beta-phosphate <=> ADP + 2,3,2',3'-tetrakis(3-hydroxytetradecanoyl)-D- glucosaminyl-1,6-beta-D-glucosamine 1,4'-bisphosphate. This enzyme is involved in the synthesis of lipid A portion of the bacterial lipopolysaccharide layer (LPS). The family contains a P-loop motif at the N-terminus.
PRK00652	lpxK	7.37e-75	474	824	19	325	tetraacyldisaccharide 4'-kinase; Reviewed
pfam04413	Glycos_transf_N	3.61e-70	35	215	1	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84301.1	0.0	1	827	1	827
AEC00854.1	0.0	1	825	1	824
AKT54066.1	0.0	1	827	1	834
QNH55247.1	0.0	1	825	1	832
ANR70603.1	0.0	1	825	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EHX_A	1.10e-39	477	756	9	265	Crystalstructure of LpxK from Aquifex aeolicus at 1.9 angstrom resolution [Aquifex aeolicus VF5],4EHY_A Crystal structure of LpxK from Aquifex aeolicus in complex with ADP/Mg2+ at 2.2 angstrom resolution [Aquifex aeolicus VF5],4ITL_A Crystal structure of LpxK from Aquifex aeolicus in complex with AMP-PCP at 2.1 angstrom resolution [Aquifex aeolicus VF5],4ITM_A Crystal structure of 'apo' form LpxK from Aquifex aeolicus in complex with ATP at 2.2 angstrom resolution [Aquifex aeolicus VF5],4ITN_A Crystal structure of 'compact P-loop' LpxK from Aquifex aeolicus in complex with chloride at 2.2 angstrom resolution [Aquifex aeolicus VF5],4LKV_A Determinants of lipid substrate and membrane binding for the tetraacyldisaccharide-1-phosphate 4 -kinase LpxK [Aquifex aeolicus VF5],4LKV_B Determinants of lipid substrate and membrane binding for the tetraacyldisaccharide-1-phosphate 4 -kinase LpxK [Aquifex aeolicus VF5],4LKV_C Determinants of lipid substrate and membrane binding for the tetraacyldisaccharide-1-phosphate 4 -kinase LpxK [Aquifex aeolicus VF5],4LKV_D Determinants of lipid substrate and membrane binding for the tetraacyldisaccharide-1-phosphate 4 -kinase LpxK [Aquifex aeolicus VF5]
4EHW_A	1.15e-39	477	756	11	267	Crystalstructure of LpxK from Aquifex aeolicus at 2.3 angstrom resolution [Aquifex aeolicus VF5]
2XCI_A	3.30e-34	40	392	30	344	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	2.46e-16	236	427	40	231	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL1	1.36e-70	473	814	26	366	Tetraacyldisaccharide 4'-kinase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxK PE=3 SV=1
B8CZC3	1.81e-70	450	820	10	383	Tetraacyldisaccharide 4'-kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=lpxK PE=3 SV=1
A5G6H1	3.25e-65	446	807	1	344	Tetraacyldisaccharide 4'-kinase OS=Geotalea uraniireducens (strain Rf4) OX=351605 GN=lpxK PE=3 SV=1
B8F928	2.89e-64	472	822	25	364	Tetraacyldisaccharide 4'-kinase OS=Desulfatibacillum aliphaticivorans OX=218208 GN=lpxK PE=3 SV=1
P0AC77	3.59e-63	22	430	23	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999917	0.000114	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
3	25
469	491