CAZyme Information: MGYG000001317_00464

Basic Information

• Species: Citrobacter portucalensis_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter portucalensis_A
• CAZyme ID: MGYG000001317_00464
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000001317_6|CGC4	45180.09	6.3832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001317	5150259	Isolate	not provided	not provided

• Gene Location: Start: 277956; End: 279146 Strand: +

Full Sequence      

MLNHIVEESLRAFPGSPVNPGSFQDQMSSARKHVLELISRHLTEFGEQFPAETCVQGFYP
LTENVEWTTSFWTGQLWLAWEMSGESKFREMAEKHVRSFGLRIAGRHDTNTHDLGFLYTL
SCVAAWRLTGNRDARGFSLMAAEALLERFHEKAQIIQAWGDLRDPEQAGRMIIDCNMNLP
LLYWASEQTGDPRFALAAKAHVAQAAKYLIRQDASTFHTYYMDVQTGAPRYGNTQQGYAD
DSCWSRGQAWGIYGFLLSYIYTGDTRMVQLSKKLANYFLNRLPEDAVCHWDLALVGTDAL
RDSSSAAIAVCGLLELIKHLPVTDPDRERYQQWAMGIMSSLTRHYLMGKDEQGNGLLKHS
VYHLSSNKGVDECASWGDYFYVEALMRFTQSWKLYW

Enzyme Prediction     

No EC number prediction in MGYG000001317_00464.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	62	388	3.6e-129	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.68e-19	52	388	14	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATX04706.1	3.53e-297	1	396	1	396
APR31941.1	1.44e-296	1	396	1	396
ARC42970.1	1.44e-296	1	396	1	396
QGJ39697.1	3.63e-290	1	396	1	396
QGJ53257.1	3.63e-290	1	396	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZR_A	3.08e-112	19	396	13	397	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.18e-112	19	396	14	398	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	1.81e-111	19	396	14	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	1.81e-111	19	396	14	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]
3WUX_A	1.03e-110	19	396	14	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DR77	1.30e-118	24	396	24	396	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	1.74e-111	19	396	14	398	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	3.29e-109	24	396	27	399	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	9.99e-103	35	396	10	372	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
T2KLZ3	7.60e-41	66	387	76	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001317_00464.