CAZyme Information: MGYG000001317_01078

Basic Information

• Species: Citrobacter portucalensis_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter portucalensis_A
• CAZyme ID: MGYG000001317_01078
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896	MGYG000001317_8|CGC1	102184.02	5.6664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001317	5150259	Isolate	not provided	not provided

• Gene Location: Start: 4282; End: 6972 Strand: -

Full Sequence      

MTTHSGSTAREVRFPLGGIGTGCISLAGNGHLTDVEIFNHPDKGYHHGYTHFAVKAERNG
ALVDARILQGDWQGNACGQWQIHDRLRKRHTGYGVGPDAETLAGMPHFAHSEFDGEFPMA
QMSFSDPEFPGNIRMLAFNPFIPCDEDNSSLPLAWFELEVENTTDAALDYTLCLSLCNGL
APDSTHNRHEIREDRHMMTLTQRHYPADDPRYAELATTTDAQDVSWQTYWYRGDWFDSLT
MFWRDFCGQPRLPEREYTQSQPGFADHASLAAHLHLAAGERGRVRFWTGWYCPVTYNYWT
DWRDRATQELVHYDDYRGQKTWKNHYATRFTDVNAVLDYAVSNAEFLFSRTQAFHDALHD
SSLPDSVRDAVSANLAVLKSPTCLRLEDGSLWGWEGVLEDIGCCEGSCTHVWHYALALPW
LFPRLSRSMRDLNQRHNLRPSGSLRFRLRLPPGDDPFEFRACADGQFGEVLAIYRDWLLC
GDRAWLEEKWSAVRDMLRFAWNPDNPDQWDPEQRGVLTGRQHHTLDMELFGPNPWLTGLY
IAALEAGCAIANHLGHNDDAMLWQDIARRGRVTLRERLFNGEYFQQVIDLANRDTLAPWR
TSAESADYGLSGDVWQQYWCEENHEVKYQFGSGCHIDQLMGQWFAGLCGLPPVFDPGQTQ
RALRALWQYNFVSARHHTNPCRLYGLNDEQGVSICSWPTGDMPAIPVPYAQEMMTGFEYQ
LAALMVASGMATEGETLTRAIRDRYRGDNRNPWNEMECGSHYARSMASYGLLLAYSGVRY
CADTGHLAFHPALTPGHHYYFWSAGDAWGTVSATTHTCTLTVIHGTLTLNEFGWPFDLPL
WRITLNNAPLEAGEDRRHTLRFPEGITLNDGDRLRILLRDTRLTHTEEETACLTHP

Enzyme Prediction     

No EC number prediction in MGYG000001317_01078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	394	770	2e-58	0.9807162534435262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12215	Glyco_hydr_116N	1.39e-51	14	345	2	307	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	6.60e-37	411	771	19	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	2.29e-34	15	779	16	721	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD5354947.1	0.0	4	877	3	872
QGG08411.1	0.0	4	877	3	872
AUJ81895.1	0.0	4	796	3	791
QGQ98288.1	2.57e-286	4	878	5	870
QHW31016.1	1.50e-283	4	868	5	854

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5M868	1.26e-18	15	767	144	867	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q69ZF3	1.97e-17	15	767	144	867	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q9HCG7	1.21e-15	15	767	153	876	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q7KT91	6.05e-10	508	733	704	890	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999091	0.000702	0.000224	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001317_01078.