CAZyme Information: MGYG000001317_02304

Basic Information

• Species: Citrobacter portucalensis_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter portucalensis_A
• CAZyme ID: MGYG000001317_02304
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
972	MGYG000001317_10|CGC2	108397.45	6.9967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001317	5150259	Isolate	not provided	not provided

• Gene Location: Start: 52877; End: 55795 Strand: -

Full Sequence      

MTLSLKWVGLLFAALLPCAHAAQFSQQGNEVTVRHGDYTLRYHLNSGEGDILWRDTPLIA
GFHSEAQLQALTLNSQQASQRSSEWQTINDKRWGQGNKLALTARFADGRTLTTDFWFFDD
KPWLLSDMMVSAPTTQTVSRLTPIAAAFADIGVGSDKRIYTTPYTNNFDFGVAPVNRFGL
SQNGTDRFADPQEPMVKFNGISHWVTALFDNQNRHGLVAGAATVQKWKSSQQLGEAKQPN
APLSQFALYNWGGEQRGTQVASDLFFLGYFSDYRDGLETYGAVYNQGEPGMRWQGKVPVG
FNAFYSHDSYGKARDMYAMTDYIARQLKPLGYEYVNMDGGFQPDGYPQGMTAFTSYVHKK
GLKAGGYLTPFAIYENWLDLPVDNTGYTHRDACLKDKNGKLIKTYLGSYALDMSHPAAQY
IVRRNIKNYIDWGFDYIKLDFLDMGLYEGQHYDPSVNGIQNYRLGMQIMRDEALKAQHPV
FLDASISPLLPAAFTQGRRAACDTSLGVADYSGIERQAFNSALSWWSNGTLYRYNDADMF
VPEQLLQGDNRSGQRAALRLATAVAMDGGHWLVGDNLPFVDEDRSAWLENKALLALATTG
VAARPLRLNNVYHQGEHSPEVLVQRAPDNSVYVSLTNWSDTEKSWQLSAAELGLTGSAPW
QVNSLFDGIRWQQTTAEIHYRLAAGETAILHFTHTPQSPVQPPHDLAAGLQLHRADNSFT
LTFPRPTRLNQVTIQEPAPFAMRNYTLSWGDGAQWHPLTRGYLVGDRRSVAFPEVNARQI
RLSYLDSKGNVQPPQINAYHAASAVPAMRIVSDGPQSGEKRFDLQGANQLLQTFTLSHSS
LPKIDFWLFENYVNAVPGDNFRVQIVQLNAHDIPEKTLFSAALPPFNLPAKPAIYSLWPR
LKGLDKHKRYGLLLSSQDSTVSDAAGTNSYGTLSSDSAHYAGGKLRRSSDGGKSWQDAPS
QTLLFTLYSNER

Enzyme Prediction     

No EC number prediction in MGYG000001317_02304.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	424	666	8.9e-16	0.925764192139738

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	8.41e-27	298	596	3	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	7.64e-18	298	539	2	215	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16499	Melibiase_2	2.13e-05	318	440	33	132	Alpha galactosidase A.
PLN02692	PLN02692	1.93e-04	298	481	57	205	alpha-galactosidase
PLN02808	PLN02808	0.001	327	367	63	116	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYN29307.1	0.0	19	969	18	967
AJQ98020.1	0.0	8	969	13	981
QQE42004.1	0.0	8	969	13	981
AYQ71140.1	5.72e-305	23	971	38	1027
ANS75585.1	2.57e-256	25	968	40	1027

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LCJ_A	9.34e-07	326	519	184	370	TtGalA,alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_B TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_C TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_D TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_E TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_F TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCK_A TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCK_B TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCK_C TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCL_A TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8],6LCL_C TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8],6LCL_E TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000301	0.998933	0.000227	0.000188	0.000171	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001317_02304.