CAZyme Information: MGYG000001318_00418

Basic Information

• Species: Enterobacter cancerogenus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cancerogenus
• CAZyme ID: MGYG000001318_00418
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	MGYG000001318_8|CGC1	77865.96	8.4131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001318	4633453	Isolate	not provided	not provided

• Gene Location: Start: 72921; End: 75002 Strand: -

Full Sequence      

MESKRLDSAAQAAGISLSYINAHGKPQSIGAETKRRLLDAMHNTGAKASASPVPNVKVFT
AGKKMSLTVEGRGEFSWQLTTEAGQAHTGHATGGKRFTLPAKLPEGYHTLTLTQNDKPFA
CRVIVAPKRCYEPQALVEGKKLWGACVQLYTLRSDSNWGIGDFGDLKKMLSSVGERGGAF
IGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNALDDFKNSKEAQAWWRLETTQQML
KQARDAEWVDYSAVTSLKMAALRLAWKGFAKRDDEQMAAFRQFVAREGESLYWQAAFDAL
HAYQVKEDEMRWGWPVWPKAYQRVDTPEVKAFCKKYADEVDFYLWLQWLAYSQFAACWQV
SQGYNMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPH
VMAARAYQPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLLSI
LALESKRHQCMVIGEDLGTVPVEIVSKLRDSGVYSYKVLYFESDHEKTFRAPKAYPEQSM
AVATTHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKHGCLP
KRAGHKASLMAMTSTLNRGLQRYIADSNSALLGLQPEDWIDMAEPVNIPGTSYQYKNWRR
KLSVGLEAMFTDEGVNRLIKDLDKRRRALTKKR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	147	684	1.9e-162	0.9898785425101214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00217	malQ	0.0	128	684	1	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1640	MalQ	0.0	130	688	1	518	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK11052	malQ	0.0	1	692	1	695	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	0.0	6	689	8	724	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	0.0	147	664	1	459	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD5359492.1	0.0	1	693	1	693
QGG10603.1	0.0	1	693	1	693
QZY36611.1	0.0	1	693	1	693
AUJ83402.1	0.0	1	693	1	693
QPO60963.1	0.0	1	692	1	692

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	0.0	1	685	1	686	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	0.0	2	685	2	686	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	1.46e-75	93	658	129	673	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
1TZ7_A	1.03e-20	145	557	24	415	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	0.0	1	693	1	694	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	8.70e-166	74	675	81	686	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P9WK22	6.88e-94	29	672	45	703	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P65337	6.88e-94	29	672	45	703	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK23	6.88e-94	29	672	45	703	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001318_00418.