CAZyme Information: MGYG000001318_02293

Basic Information

• Species: Enterobacter cancerogenus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cancerogenus
• CAZyme ID: MGYG000001318_02293
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42418.56	7.4398

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001318	4633453	Isolate	not provided	not provided

• Gene Location: Start: 20003; End: 21151 Strand: -

Full Sequence      

MVDSRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPLMQAEGCEAWYEMEEL
AVMGIVEVLGRLRRLLHIRADLTRRFTDLKPDVFVGIDAPDFNITLEGNLKKQGIKTIHY
VSPSVWAWRQKRVFKIGRSTNLVLAFLPFEKAFYDRFNVPCRFIGHTMADAMPLDPDKNA
ARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQILRQTYPDLEVVVPLVNAKRREQ
FERIKAEVAPDLHIHLLDGKGREAMVASDAALLASGTAALECMLAKCPMVVGYRMKPFTF
WLAKRLVKTDYVSLPNLLAGRELVKELLQEECQPQALADALLPLLANGKTSHLMHETFRE
LHQQIRCNADEQAAEAVLELAK

Enzyme Prediction     

No EC number prediction in MGYG000001318_02293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	366	5.1e-141	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	380	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	6	382	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	6	382	1	376	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	0.0	9	377	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.63e-49	11	328	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUJ82836.1	7.73e-278	1	382	1	382
QGG09483.1	2.22e-277	1	382	1	382
CAD5352861.1	3.15e-277	1	382	1	382
QFQ07905.1	2.38e-272	1	382	1	382
ASV54172.1	4.79e-272	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.55e-257	1	382	1	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.91e-256	1	382	1	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4W6S7	5.09e-268	1	382	1	382	Lipid-A-disaccharide synthase OS=Enterobacter sp. (strain 638) OX=399742 GN=lpxB PE=3 SV=1
A8ALA6	4.00e-265	1	382	1	382	Lipid-A-disaccharide synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=lpxB PE=3 SV=1
B6HZF6	3.83e-263	1	382	1	382	Lipid-A-disaccharide synthase OS=Escherichia coli (strain SE11) OX=409438 GN=lpxB PE=3 SV=1
B7LGP4	3.83e-263	1	382	1	382	Lipid-A-disaccharide synthase OS=Escherichia coli (strain 55989 / EAEC) OX=585055 GN=lpxB PE=3 SV=1
B5RHG7	5.44e-263	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001318_02293.