CAZyme Information: MGYG000001318_03644

Basic Information

• Species: Enterobacter cancerogenus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cancerogenus
• CAZyme ID: MGYG000001318_03644
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
173	MGYG000001318_10|CGC17	19142	7.3151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001318	4633453	Isolate	not provided	not provided

• Gene Location: Start: 1473655; End: 1474176 Strand: -

Full Sequence      

MPVKRAMQWMPISEQAGKAWGVSPRLVTAIIAVESGGNPTLVSKSNAVGLMQLKASTAGR
EVYRYMGWSGQPSTSELKNPERNISMGTAYLSILEHGILKGIEDPEVMQYALVVSYVNGA
GALLRTFSSDRKEAIEEINDMDKDEFFEHVVKNHPAPQAPRYIWKVQKAMDAM

Enzyme Prediction     

No EC number prediction in MGYG000001318_03644.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	8	171	1.1e-16	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	1.39e-128	1	173	31	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	2.19e-83	11	170	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.66e-57	4	169	187	352	membrane-bound lytic murein transglycosylase MltC.
COG0741	MltE	8.29e-31	3	171	133	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	9.42e-29	15	138	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD5356281.1	1.46e-123	1	173	1	173
QZY35199.1	1.71e-122	1	173	31	203
AUJ81258.1	1.71e-122	1	173	31	203
QGG07793.1	1.71e-122	1	173	31	203
AVL19142.1	2.00e-121	1	173	31	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	5.49e-100	1	173	14	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	7.47e-100	1	173	31	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	1.57e-99	1	173	14	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	1.57e-99	1	173	14	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	1.57e-99	1	173	14	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4WBE8	3.02e-117	1	173	31	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Enterobacter sp. (strain 638) OX=399742 GN=emtA PE=3 SV=1
A7MKC3	5.35e-111	1	173	31	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
A8AFS5	7.28e-109	1	173	31	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
B5R2X1	7.76e-104	1	173	31	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=emtA PE=3 SV=1
C0Q334	7.76e-104	1	173	31	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001318_03644.