CAZyme Information: MGYG000001319_00845

Basic Information

• Species: Butyrivibrio_A crossotus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A crossotus
• CAZyme ID: MGYG000001319_00845
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	MGYG000001319_11|CGC7	66808.01	7.0899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001319	2482799	Isolate	not provided	not provided

• Gene Location: Start: 722551; End: 724302 Strand: -

Full Sequence      

MSKINKAVKYIKEYGFVKTAKAVKTKLCSGKAATAKKLKRIIKESYDHKEFEQLNTSLKI
SILMPVYNTDVDMLKCVMESVINGSYDNYELCIYDASDENGRDATKICEDYAGKFPKIKY
LKGDNFGIAENTNRCFDISEGGYIALLDHDDVLHRDALCYVAMEACKGADFIYTDEVTFS
GKITNVVSSDFKPDYSPYMLRCNNYICHFVCFSRELFVSCGKFNKKYDGSQDHELFLRLT
DRAKKVCHIPKILYFWRVHKGSVSDSIEAKEYAITAGINGVRDFLASKNIDAEVESSEIY
PTIYRIHYKITDEKVSVIILNHNHYEDLKRCLESIYRSTYKNYEIIILENNSNDQVLSDY
YAELSKKENIKIITLNEPFNYSRFNNIAAGYAAGTQLLFLNNDIEAVSENWIQEMLMYSQ
RNDVGAVGAQLRYPDKTLQHCYLITGAGPHKVAIHAGLGLFEGDYGYLDRIGFVRDVSAV
TGACLMVKKDIFDKIGGFDEKLSVAYNDVDICLKIRNEGYGIIYTPYARLIHYESGTRGR
DSKDSNRRRLDAEAEYIKNKWKDKLIDRYYNANFSTDREGMLR

Enzyme Prediction     

No EC number prediction in MGYG000001319_00845.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	316	495	2.7e-19	0.9882352941176471
GT2	61	184	3.9e-17	0.7235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.44e-64	59	258	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.98e-43	317	534	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.52e-39	314	566	4	253	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	3.32e-17	61	262	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.79e-16	316	435	1	119	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1243278.1	1.65e-167	6	579	447	1028
QUO22278.1	2.92e-163	58	577	96	622
ACD24731.1	3.09e-161	47	579	559	1101
CDH92150.1	3.09e-161	47	579	559	1101
QMW89744.1	2.08e-154	6	579	30	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.45e-07	313	415	5	105	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.03e-95	60	578	368	892	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.46e-62	60	542	321	802	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q9CMP0	1.01e-13	60	382	435	774	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q7BLV3	1.22e-12	50	525	432	880	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
P9WMY2	8.36e-09	328	541	18	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001319_00845.