CAZyme Information: MGYG000001320_01170

Basic Information

• Species: Peptacetobacter hiranonis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptacetobacter; Peptacetobacter hiranonis
• CAZyme ID: MGYG000001320_01170
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		59339.84	9.5779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001320	2423386	Isolate	not provided	Asia

• Gene Location: Start: 646069; End: 647673 Strand: +

Full Sequence      

MKKRMAAASLAMIPMLTMNVNAENIKTGIVSSAYLNVRYSPSASAKLQLVLKKGNKVTVI
GEKNGWYKIKTATGKTGWVVSKYISLKADAIRKDTRGIKKIVTATTLNVRSGPDTSYTSI
GKLYKNNEVDVISESNGWSKIQFGSKVGYVSSEYLKATTTDNNNSGITGNSQGTKKTIQE
VTSSLLHVRNGAGGQYTKIDTLHKGDKVVVSSIENNWAKVEYDGKNGYVSSIYLKYVSDK
IDDDSTDINGTASDIIQGAYTQRSQKDYSLEDMVEAQYIKGQSGGNLISRQTNRLSDILN
PQESSFTTYLMRKDTRAYGAPTKEELEYYLDPSNFTSYKDGIMQFVRLDRYTDSITAKSL
NNYFESRGSECIFNGKGQAFIDAAKKYNIDVLYFVSHAMWETGNGKSKLAQGQLVTSVDG
VPLETPVTVYNFFGIGATDGNALEGGKMTAYKNGWTTVEKGIDGAAKWISDGYIHNSKYK
QNTVYSMRWCYEYTWHQYATDVNWANGISKMMSSLMTRYGNGKNLLIDIPEYKY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	377	514	1.3e-27	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	4.16e-51	318	533	37	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
COG3103	YgiM	4.50e-21	1	157	1	151	Uncharacterized conserved protein YgiM, contains N-terminal SH3 domain, DUF1202 family [General function prediction only].
smart00047	LYZ2	4.45e-17	374	524	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam08239	SH3_3	4.17e-11	105	156	1	54	Bacterial SH3 domain.
pfam08239	SH3_3	8.85e-11	35	85	3	54	Bacterial SH3 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK21005.1	0.0	1	534	1	534
QQQ85875.1	0.0	1	533	1	533
AXU34918.1	6.20e-142	1	533	1	603
AXU31130.1	6.20e-142	1	533	1	603
AXU27329.1	6.20e-142	1	533	1	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WQW_A	1.73e-39	325	532	46	269	X-raystructure of catalytic domain of autolysin from Clostridium perfringens [Clostridium perfringens str. 13]
4PI7_A	1.98e-30	322	534	26	227	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PI9_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PIA_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
6FXO_A	5.57e-30	344	533	63	244	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]
4PI8_A	1.34e-29	322	534	26	227	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
6U0O_B	5.31e-21	295	534	52	272	ChainB, LYZ2 domain-containing protein [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39848	1.27e-35	322	533	683	880	Beta-N-acetylglucosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lytD PE=1 SV=1
O33635	2.79e-28	344	533	1154	1335	Bifunctional autolysin OS=Staphylococcus epidermidis OX=1282 GN=atl PE=1 SV=1
Q5HQB9	2.79e-28	344	533	1154	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=atl PE=3 SV=1
Q8CPQ1	4.97e-28	344	533	1154	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=atl PE=3 SV=1
Q931U5	8.64e-27	344	533	1067	1248	Bifunctional autolysin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=atl PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000369	0.998787	0.000215	0.000220	0.000203	0.000184

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001320_01170.