CAZyme Information: MGYG000001320_01524

Basic Information

• Species: Peptacetobacter hiranonis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptacetobacter; Peptacetobacter hiranonis
• CAZyme ID: MGYG000001320_01524
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000001320_8|CGC2	46412.83	10.371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001320	2423386	Isolate	not provided	Asia

• Gene Location: Start: 45484; End: 46698 Strand: +

Full Sequence      

MFNNSNENKVRRRNVSSSGGSSSNRIRRPDNSYDEERLRENTKSKPLFERTANDDFKRGN
TGKSALSRKNGERLQPRSNRGQNNRENLNNKEKEYDYSMLPSERKKRARENANVSNSRMN
DSRNSVSDDVKFNYGAREKERESSRDREIIKKTRKSSKNKKNKKKEIKSKVFYYVSRIVA
MLLVLCIVAGACGIGYAKYVTKDMPEVTAKMVHEKYISSKEVPIKDMPKNLRNAIVAIED
ERFYKHDGVDKKALARSLIHNILTDSRQGGSTIEMQLSKNLLTSSEVSIKRKIMDMYNAV
GMNRVMKKDEILEAYLNNIYFGQNAYGVAAGAELYFGKNVKDLDLAESAMLVGITNNPKI
YSNYSAAKTRQKIILKKMYELGYIKEAQYKEAVAEMVHFRSEIE

Enzyme Prediction     

No EC number prediction in MGYG000001320_01524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	218	379	2.8e-59	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	8.02e-72	222	379	16	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	6.44e-71	222	395	5	182	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	9.59e-69	182	403	12	255	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	6.59e-67	222	395	79	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	4.52e-45	181	395	9	246	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK21304.1	1.41e-266	1	404	1	404
QQQ87251.1	3.31e-265	1	404	1	404
QQY46883.1	7.80e-79	175	404	109	338
AVD38751.1	7.80e-79	175	404	109	338
QFS31062.1	7.80e-79	175	404	109	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	3.30e-36	222	393	23	198	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	6.45e-36	222	393	23	198	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	2.77e-35	222	397	43	247	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3UDF_A	7.04e-35	222	398	42	222	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
4OON_A	3.02e-33	220	398	38	222	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GHV1	1.84e-39	222	396	79	266	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A7FY32	1.85e-39	222	396	79	266	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	1.85e-39	222	396	79	266	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
Q07259	1.36e-38	182	400	11	231	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O05131	1.04e-36	224	399	73	252	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
173	195