CAZyme Information: MGYG000001320_01655

Basic Information

• Species: Peptacetobacter hiranonis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptacetobacter; Peptacetobacter hiranonis
• CAZyme ID: MGYG000001320_01655
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000001320_8|CGC3	50430.44	9.2121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001320	2423386	Isolate	not provided	Asia

• Gene Location: Start: 199739; End: 201160 Strand: +

Full Sequence      

MNLKKTMTICLASTMAAGSLVPAMAAEKEIIEGKNIYETAGLIADKQNYSTAILVNLDNS
IADGLSASGLSGAANAPILLTKKDSIPTETMQRLKNVNKVYIIGLEAAVSKSVENTLKDK
GISVERLGGSDRNNTSYSVANKISQLKNITSIALTNGVKGEADSISIASTAARDGMPVIL
TNGKNVEYNTKNVTTYAIGGTSVISDKLVKSTNAIRLGGSDRYKTNKIILDKFYPNAKEY
YVADGYDLKNALVGSTLAKDAPLMLVSKGSDKSVFKGANKISKIGTLSSSIFEDCLRRAS
SSSSSTNVSSGLSILSKPTSTYEQCKKWAESKNASDLFMEILPILYNTAVENGVDPTLVV
AQCAKETGYCKFGGVLDASFKNPCGLKTPGGGGDKDKNAHTRFDSWEDGVLAQVQHLALY
AGKEGYPLSNPKDPRHFADLFGKCKTVKSLSNNWAGSGYGEDLEKMMKDIMSK

Enzyme Prediction     

No EC number prediction in MGYG000001320_01655.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033435	S-layer_Clost	6.01e-19	59	245	426	642	S-layer protein SlpA. In Clostridiodes difficile, the S-layer protein precursor, SlpA, is one member of a large paralogous family of protein that share several cell wall-binding repeats. SlpA is cleaved into a larger and smaller protein. The S-layer protein itself is important to adhesion, and portions of it are highly variable, and then N-terminal and C-terminal are well-conserved.
pfam04122	CW_binding_2	5.81e-16	31	112	2	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
COG2247	LytB	7.38e-15	42	194	21	174	Putative cell wall-binding domain [Cell wall/membrane/envelope biogenesis].
pfam04122	CW_binding_2	3.35e-14	126	207	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
pfam04122	CW_binding_2	2.45e-09	216	274	1	59	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK21168.1	0.0	1	473	1	473
QQQ87376.1	0.0	1	473	1	473
AXU46788.1	3.29e-196	29	470	30	476
AXU50448.1	3.29e-196	29	470	30	476
AXU64919.1	3.29e-196	29	470	30	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J6Q_A	4.73e-31	29	285	287	576	ChainA, Cell wall binding protein cwp8 [Clostridioides difficile 630]
5J72_A	1.01e-27	13	268	117	396	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
7ACX_B	5.22e-19	60	258	83	311	ChainB, S-layer protein [Clostridioides difficile],7ACX_D Chain D, S-layer protein [Clostridioides difficile]
7ACY_B	5.22e-19	60	258	83	311	ChainB, S-layer protein [Clostridioides difficile 630],7ACY_D Chain D, S-layer protein [Clostridioides difficile 630],7QGQ_B Chain B, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_D Chain D, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_J Chain J, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_K Chain K, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_L Chain L, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_M Chain M, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_N Chain N, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_T Chain T, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_U Chain U, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_V Chain V, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_W Chain W, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_X Chain X, Precursor of the S-layer proteins [Clostridioides difficile 630]
7ACZ_B	3.49e-15	59	234	82	292	ChainB, SLPH (HMW SLP) [Clostridioides difficile R20291],7ACZ_D Chain D, SLPH (HMW SLP) [Clostridioides difficile R20291]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02114	2.84e-26	5	281	6	287	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000430	0.998608	0.000226	0.000262	0.000237	0.000213

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001320_01655.